NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098158

Metagenome / Metatranscriptome Family F098158

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098158
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 50 residues
Representative Sequence ATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS
Number of Associated Samples 94
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.83 %
% of genes near scaffold ends (potentially truncated) 80.77 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.731 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(14.423 % of family members)
Environment Ontology (ENVO) Unclassified
(36.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.192 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.76%    β-sheet: 0.00%    Coil/Unstructured: 39.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02861Clp_N 61.54
PF13649Methyltransf_25 9.62
PF14081DUF4262 3.85
PF12847Methyltransf_18 2.88
PF08241Methyltransf_11 0.96
PF07813LTXXQ 0.96
PF07690MFS_1 0.96
PF05977MFS_3 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 61.54
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 3.85
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.73 %
UnclassifiedrootN/A18.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10406967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005175|Ga0066673_10318217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales908Open in IMG/M
3300005177|Ga0066690_11020236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300005332|Ga0066388_100178472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2730Open in IMG/M
3300005337|Ga0070682_100876714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae735Open in IMG/M
3300005337|Ga0070682_101988228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300005434|Ga0070709_10323538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1132Open in IMG/M
3300005434|Ga0070709_10730404Not Available772Open in IMG/M
3300005435|Ga0070714_100930619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales844Open in IMG/M
3300005436|Ga0070713_102011106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300005437|Ga0070710_11036176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae599Open in IMG/M
3300005439|Ga0070711_100401639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1112Open in IMG/M
3300005440|Ga0070705_101682802Not Available536Open in IMG/M
3300005444|Ga0070694_101753915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae529Open in IMG/M
3300005467|Ga0070706_100549078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1075Open in IMG/M
3300005614|Ga0068856_100858951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300006028|Ga0070717_11998000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300006163|Ga0070715_10019483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2603Open in IMG/M
3300006175|Ga0070712_101844510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300006575|Ga0074053_11769969Not Available623Open in IMG/M
3300006579|Ga0074054_11688125Not Available596Open in IMG/M
3300006755|Ga0079222_11174282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300006755|Ga0079222_11750245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae598Open in IMG/M
3300006806|Ga0079220_11245600Not Available618Open in IMG/M
3300006904|Ga0075424_100874374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia959Open in IMG/M
3300009011|Ga0105251_10015190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4220Open in IMG/M
3300009036|Ga0105244_10442043Not Available598Open in IMG/M
3300009092|Ga0105250_10475039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae564Open in IMG/M
3300009098|Ga0105245_10794480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli984Open in IMG/M
3300009098|Ga0105245_10834221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M
3300009148|Ga0105243_10375095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1314Open in IMG/M
3300009177|Ga0105248_11401536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae791Open in IMG/M
3300009553|Ga0105249_10090222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2865Open in IMG/M
3300009553|Ga0105249_11935376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli662Open in IMG/M
3300010046|Ga0126384_11940597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300010320|Ga0134109_10319563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300010335|Ga0134063_10721148Not Available517Open in IMG/M
3300010361|Ga0126378_13469831Not Available500Open in IMG/M
3300010362|Ga0126377_13320873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300010371|Ga0134125_11629403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli702Open in IMG/M
3300010371|Ga0134125_12416939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300010373|Ga0134128_10739823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli1091Open in IMG/M
3300010373|Ga0134128_11090797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia881Open in IMG/M
3300010867|Ga0126347_1388967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii777Open in IMG/M
3300012200|Ga0137382_11265727Not Available522Open in IMG/M
3300012207|Ga0137381_10268647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1483Open in IMG/M
3300012207|Ga0137381_10340774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1306Open in IMG/M
3300012358|Ga0137368_10896057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300012359|Ga0137385_10447270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1097Open in IMG/M
3300012501|Ga0157351_1062489Not Available516Open in IMG/M
3300012951|Ga0164300_10521380Not Available684Open in IMG/M
3300012961|Ga0164302_10762768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300013105|Ga0157369_10829330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales949Open in IMG/M
3300013307|Ga0157372_12337152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae614Open in IMG/M
3300014325|Ga0163163_12890776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300014969|Ga0157376_12185042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae592Open in IMG/M
3300015371|Ga0132258_13649195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300015372|Ga0132256_103623515Not Available519Open in IMG/M
3300016387|Ga0182040_10240440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1355Open in IMG/M
3300017959|Ga0187779_11011593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300020002|Ga0193730_1039162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1374Open in IMG/M
3300021168|Ga0210406_11256924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300021432|Ga0210384_10509087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300021478|Ga0210402_10576522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1043Open in IMG/M
3300021560|Ga0126371_10168929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2262Open in IMG/M
3300025527|Ga0208714_1074900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300025898|Ga0207692_10214869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1137Open in IMG/M
3300025900|Ga0207710_10062975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1687Open in IMG/M
3300025907|Ga0207645_10202594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys1306Open in IMG/M
3300025910|Ga0207684_10462570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1089Open in IMG/M
3300025914|Ga0207671_11444423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae532Open in IMG/M
3300025916|Ga0207663_11130823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae630Open in IMG/M
3300025922|Ga0207646_10549383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300025924|Ga0207694_10485075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1034Open in IMG/M
3300025929|Ga0207664_10453856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1144Open in IMG/M
3300025949|Ga0207667_11581855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli625Open in IMG/M
3300026377|Ga0257171_1044681Not Available765Open in IMG/M
3300027725|Ga0209178_1136835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia839Open in IMG/M
3300027910|Ga0209583_10416032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300028885|Ga0307304_10011578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2807Open in IMG/M
3300028885|Ga0307304_10440744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae592Open in IMG/M
3300028906|Ga0308309_10200872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1643Open in IMG/M
3300030494|Ga0310037_10487114Not Available501Open in IMG/M
3300030973|Ga0075395_11246483Not Available532Open in IMG/M
3300031446|Ga0170820_10655658Not Available598Open in IMG/M
3300031549|Ga0318571_10122556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales874Open in IMG/M
3300031572|Ga0318515_10216195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1028Open in IMG/M
3300031681|Ga0318572_10486563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300031723|Ga0318493_10446714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae711Open in IMG/M
3300031740|Ga0307468_101333667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea montanisoli655Open in IMG/M
3300031748|Ga0318492_10026326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2581Open in IMG/M
3300031846|Ga0318512_10227697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia917Open in IMG/M
3300031962|Ga0307479_10417724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300032770|Ga0335085_10206455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2401Open in IMG/M
3300032770|Ga0335085_11033837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium885Open in IMG/M
3300032828|Ga0335080_11741308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300032829|Ga0335070_11726633Not Available567Open in IMG/M
3300032892|Ga0335081_10378535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1831Open in IMG/M
3300032893|Ga0335069_11279101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300033004|Ga0335084_10051139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4262Open in IMG/M
3300033134|Ga0335073_12125531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura physcomitrii507Open in IMG/M
3300033158|Ga0335077_10963864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300034820|Ga0373959_0158535Not Available577Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere14.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1040696723300003505Forest SoilMGVAATAIVAHTSTLGGQGFIILLIWVAIAIINVAYARHP*
Ga0066673_1031821713300005175SoilSPVGARNVATTVTALGSMAMGVAATAIVSHTGNVGGQGFIILLIWVAIAIINVAYARRP*
Ga0066690_1102023623300005177SoilPAQVGARNVATTVTALGSMALGVAATAIVARTGTFGGQGFIILLIWVVIAIVNVAYARHP
Ga0066388_10017847213300005332Tropical Forest SoilARNVATTITALGSMALGVAATAILAHADHVAGQGFIILLVWVAIAIVNVAYARRL*
Ga0070682_10087671423300005337Corn RhizosphereITALGSVALGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARHS*
Ga0070682_10198822813300005337Corn RhizosphereLGVAATAIVAHADNLGGQGFIILLIWAAVAVINIVYARRP*
Ga0070709_1032353813300005434Corn, Switchgrass And Miscanthus RhizosphereVATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS*
Ga0070709_1073040423300005434Corn, Switchgrass And Miscanthus RhizosphereRPSPAGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0070714_10093061933300005435Agricultural SoilVGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS*
Ga0070713_10201110613300005436Corn, Switchgrass And Miscanthus RhizosphereLGVAATAIVSHAANVGGQGFIIFLIWAAIAVINTVYARRP*
Ga0070710_1103617613300005437Corn, Switchgrass And Miscanthus RhizosphereGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS*
Ga0070711_10040163933300005439Corn, Switchgrass And Miscanthus RhizosphereATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS*
Ga0070705_10168280223300005440Corn, Switchgrass And Miscanthus RhizosphereNVATTITALGSMAMGVAATAIVAHTGSLGGQGFIILLIWVAIAIINVAYARRP*
Ga0070694_10175391513300005444Corn, Switchgrass And Miscanthus RhizosphereARNVATTITALGSVALGVAATAIVSSVGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0070706_10054907813300005467Corn, Switchgrass And Miscanthus RhizosphereGVAATAIVSSAGGLGGQGFIILVIWVAIAIINVAYARRS*
Ga0068856_10085895123300005614Corn RhizosphereNVATTITALGSMAMGVAATAIVSHAADVGGQGFIILLIWAAIAVINIAYARRP*
Ga0070717_1199800013300006028Corn, Switchgrass And Miscanthus RhizosphereASTITALGSMAMGVAATAIVAHAGTVGGQGFIILLIWVAIAIINVAYARRP*
Ga0070715_1001948353300006163Corn, Switchgrass And Miscanthus RhizosphereAGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0070712_10184451013300006175Corn, Switchgrass And Miscanthus RhizosphereGARNVATTITALGSMAMGVAATAIVSHAAYVGGQGFIILLIWAAIAVINIVYARRP*
Ga0074053_1176996923300006575SoilATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARRPLLHTP*
Ga0074054_1168812513300006579SoilARNVATTITALGSVTLGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARHS*
Ga0079222_1117428213300006755Agricultural SoilRHVASTITALGSMALGVAATAIVAHADALGGQGFIILLIWVAIAIINVVNARRP*
Ga0079222_1175024523300006755Agricultural SoilRNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0079220_1124560023300006806Agricultural SoilAIVSSAGSLGGQGFIILLIWLAIAIINVAYARHS*
Ga0075424_10087437423300006904Populus RhizosphereATAIVSHAADVGGQGFIILLIWAAIAVINIAYARRP*
Ga0105251_1001519073300009011Switchgrass RhizosphereVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWVAIAIINVAYARHS*
Ga0105244_1044204323300009036Miscanthus RhizosphereVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0105250_1047503923300009092Switchgrass RhizospherePAGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWVAIAIINVAYARHS*
Ga0105245_1079448013300009098Miscanthus RhizosphereVATTITALGSVALGVAATAIVSSAGSLGGQGFIILTIWVAIAIINVAYARRS*
Ga0105245_1083422113300009098Miscanthus RhizosphereVASTITALGSMAMGVAATAIVAHAGTVGGQGFIILLIWVAIAIINVAYARRP*
Ga0105243_1037509513300009148Miscanthus RhizosphereAIVSSAGSLGGQGFIILTIWVAIAIINVAYARRS*
Ga0105248_1140153613300009177Switchgrass RhizospherePARPSPAGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0105249_1009022253300009553Switchgrass RhizosphereTTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0105249_1193537613300009553Switchgrass RhizosphereITALGSVALGVAATAIVSSAGSLGGQGFIILTIWVAIAIINVAYARRS*
Ga0126384_1194059723300010046Tropical Forest SoilSMALGVAATAVVAHAANAGGRGFIVLFIWVVIAIINVAYARRP*
Ga0134109_1031956323300010320Grasslands SoilNVATTITALGSVALGVAATAIVSYAGSLGGQGLIILLIWVAIAIINVVYARRP*
Ga0134063_1072114823300010335Grasslands SoilVATTVTALGSMAMGVAATAIVSHTGNVGGQGFIILLIWVAIAIINVAYARRP*
Ga0126378_1346983123300010361Tropical Forest SoilPSQVGTRSVATTVTALGSMALGVAATAVVAHTGTLGGRGFVILVVWVAIAIINVAYARRP
Ga0126377_1332087313300010362Tropical Forest SoilTAVVAHTGTLGGRGFVILVVWVAIAIINVAYARRP*
Ga0134125_1162940323300010371Terrestrial SoilRNVATTITALGSVALGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARHS*
Ga0134125_1241693923300010371Terrestrial SoilGVAATAIVSHAADVGGQGFIILLIWAAIAVINIAYARRP*
Ga0134128_1073982333300010373Terrestrial SoilATTITALGSVALGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARHS*
Ga0134128_1109079723300010373Terrestrial SoilMALGVAATAIVAHAANVGGQGFIILLIWAAIAVINIVYARRP*
Ga0126347_138896713300010867Boreal Forest SoilVATTIIALGSMTLGVIATAIVAHAADLGGQGFIILLIWAAIAVVNIAHARRP*
Ga0137382_1126572713300012200Vadose Zone SoilVATTITALGSMAMGVAATAIVSHTGNVGGQGFIILLIWVAIAIINVAYARRP*
Ga0137381_1026864713300012207Vadose Zone SoilARPSQLGARHVAATITALGSMAMGVAATAIVAHAGNLGGQGFIILLVWVAIAIINVAYARRP*
Ga0137381_1034077413300012207Vadose Zone SoilVATTITALGSTALGVAATAVVSHASNSGGQAFMVLLIWVAIAIINVAYARRP*
Ga0137368_1089605713300012358Vadose Zone SoilVATTITALGSVALGVAATAIVSYAGSLGGRGLIILLIWLIWVAIAIINVAYARRP*
Ga0137385_1044727033300012359Vadose Zone SoilVATTITALGSMAMGVAATAIVAHTGSLGGQGFIILLIWLIWVAIAIINVAYARRP*
Ga0157351_106248923300012501Unplanted SoilMTITALGSVALGVAATAIVSYAGSLGGRGLIILLIWVAIAIINVAYARRP*
Ga0164300_1052138013300012951SoilVATTITALGSVALGVTATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS*
Ga0164302_1076276823300012961SoilVATTITALGSVALGVAATAIVSSAGGLGGRGFVILLIWVAIAIINVAYARRP*
Ga0157369_1082933033300013105Corn RhizosphereVGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWVAIAIINVAYARHS*
Ga0157372_1233715233300013307Corn RhizosphereGSVALGVAATAIVSSAGGLGGRGFIILLIWVAIAIINVAYARHS*
Ga0163163_1289077633300014325Switchgrass RhizosphereGARHVASTITALGSMAMGVAATAIVAHAGHLGGQGFIILLIWVAIAIINVVYARRP*
Ga0157376_1218504213300014969Miscanthus RhizosphereTALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS*
Ga0132258_1364919533300015371Arabidopsis RhizosphereARHVATTITALGSMAMGVAATAIVAHAGTLGGQGVIILLIWVAIAIINVAYARRPLLHTP
Ga0132256_10362351513300015372Arabidopsis RhizosphereATTITALGSMALGVAATAIVSYAGSLGGQVFIILLIWVAIAIINVAYARRS*
Ga0182040_1024044023300016387SoilVATTVTALGSMALGVAATATLAHTGTLGGRGFIILIVWVAIAIINIAYARRP
Ga0187779_1101159313300017959Tropical PeatlandGQRNVATTVTALGSIALGVGATAVVSHSSNAGGQAFMVLLIWVAIAIINVVYARRP
Ga0193730_103916213300020002SoilVGARNVATTITALGSVALGVAATAIVSSVGSLGGQGFIILTIWVAIAIINVAYARRS
Ga0210406_1125692423300021168SoilSMAMGVAATAIVAHAGTLGGQGFIILLIWVAIAIINVAYARRP
Ga0210384_1050908733300021432SoilPSQLGARHVASTITALGSMAMGVAATAIVAHAGALGGQGFIILLIWVAIAIINVAYARHP
Ga0210402_1057652223300021478SoilTALGSMAMGVAATAIVAHTGNIGGQGFIILLIWVAITIINVAYARRP
Ga0126371_1016892943300021560Tropical Forest SoilVTALGSMALGVAATAILSHTGTLGGRGFIILIVWVAIAIINVAYARRP
Ga0208714_107490013300025527Arctic Peat SoilSEVGARNVATTITALGSMAMGVAATAIVSHAPNVGGQGLIILLIWAAIAVVNVVYARRP
Ga0207692_1021486933300025898Corn, Switchgrass And Miscanthus RhizosphereARPSPAGARNVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWVAIAIINVAYARHS
Ga0207710_1006297543300025900Switchgrass RhizosphereTALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS
Ga0207645_1020259423300025907Miscanthus RhizosphereMAMGVAATAIVAHAGTVGGQGFIILLIWVAIAIINVAYARRP
Ga0207684_1046257023300025910Corn, Switchgrass And Miscanthus RhizosphereGSVALGVAATAIVSSAGSLGGQGFIILVIWVAIAIINVAYARRS
Ga0207671_1144442323300025914Corn RhizosphereGARNVATTITALGSVALGVAATAIVSSAGGLGGRGFIILLIWVAIAIINVAYARHS
Ga0207663_1113082313300025916Corn, Switchgrass And Miscanthus RhizosphereVATTITALGSVALGVAATAIVSSAGGLGGQGFIILLIWVAIAIINVAYARHS
Ga0207646_1054938333300025922Corn, Switchgrass And Miscanthus RhizosphereTITALGSMAMGVAATAIVAHAGHLGGQGFIILLIWVAIAIINVVYARRP
Ga0207694_1048507513300025924Corn RhizosphereGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS
Ga0207664_1045385633300025929Agricultural SoilRPSPVGARNVATTITALGSVALGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARH
Ga0207667_1158185513300025949Corn RhizosphereVGARSVATTITALGSVALGVAATAIVSSAGGLGGRGFIILLIWVAIAIINVAYARHS
Ga0257171_104468123300026377SoilGSMALGVAATAIVSYAGSLGGQGFIILLIWVAIAIINVAYARRP
Ga0209178_113683513300027725Agricultural SoilLGSMAMGVAATAIVSHAADVGGQGFIILLIWAAIAVINIAYARRP
Ga0209583_1041603223300027910WatershedsMAMGVAATAIVAHAGTLGGQGFIILLIWVAIAIINVAYARRP
Ga0307304_1001157853300028885SoilGSVALGVAATAIVSSVGSLGGQGFIILTIWVAIAIINVAYARRS
Ga0307304_1044074413300028885SoilALGVAATAIVSYAGNLGGQAFIILLIWVAIAIINVAYARRP
Ga0308309_1020087213300028906SoilATAIVAHTGTLGGQGFIILLIWVAIAIINVAYARHP
Ga0310037_1048711423300030494Peatlands SoilATTITALGSMALGVAATAIVSHDNHPGGQAFMVLLIWVAIAVVNVAYARRP
Ga0075395_1124648313300030973SoilALGVAATAIVSYAGSLGGRGLIILLVWVAIAIINVANARRP
Ga0170820_1065565813300031446Forest SoilSMAMGVAATAIVAHTGNIGGQGFIILLIWVAIAIINVAYARRP
Ga0318571_1012255623300031549SoilVANTVTALGSMALGVAATAIVANAGMMGGRGFIILLIWAAVAIINVAYARRP
Ga0318515_1021619513300031572SoilMALGVAATAIVANAGMMGGRGFIILLIWAAVAIINVAYARRP
Ga0318572_1048656313300031681SoilANTVTALGSMALGVAATAIVANAGMMGGRGFIILLIWAAVAIINVAYARRP
Ga0318493_1044671423300031723SoilTVTALGSMVLGAAATAIVSHGDTLGGRGFVILVIWVAIAIINVAYARRP
Ga0307468_10133366713300031740Hardwood Forest SoilARNVATTITALGSVALGVAATAIVSSAGSLGGQGFIILLIWVAIAIINVAYARHS
Ga0318492_1002632653300031748SoilTVTALGSMALGVAATATLAHTGTLGGRGFIILIVWVAIAIINIAYARRP
Ga0318512_1022769713300031846SoilVAATAIVANAGMMGGRGFIILLIWAAVAIINVAYARRP
Ga0307479_1041772413300031962Hardwood Forest SoilTITALGSMALGVAATAVVSHATNSGGQAFMVLLIWVAIAVINVAYARRP
Ga0318559_1038268023300032039SoilGSIALGVAATAVVAHAANDGGRGFIVLLIWVAIAVINVAYARRS
Ga0335085_1020645513300032770SoilNTVTALGSMALGVAATAILAHGDTMGGRGFIILLIWVAIAIINVAYARRP
Ga0335085_1103383713300032770SoilGVGATAILSHAGHVGGQGFIILLVWVAIAIVNVAYARRL
Ga0335080_1174130813300032828SoilLGSMALGVAATAIVAHGDTMGGRGFIILLIWVAIAIINVAYARRP
Ga0335070_1172663313300032829SoilVTALGSMALGVAATAVVSHGDTLGGRGFVILVIWIAIVIINVAYARRP
Ga0335081_1037853513300032892SoilGSMALGVAATAVVSHGDTLGGRGFVILVIWVAIVIINVAYARRS
Ga0335069_1127910113300032893SoilLGVAATAIIAHAANVGGQGFIILLIWAAIAIINIVYARRP
Ga0335084_1005113913300033004SoilMALGVAATAIVSYAGSLGGQVFIIVLIWVAIAIINVAYARRP
Ga0335073_1212553113300033134SoilSVALGVAATAIVSSAGSLGGRGFIIVLIWVAIAIINVAYARHS
Ga0335077_1096386423300033158SoilSPAGQRNVATTVTALGSMALGVAATAIVSHSGNSGGQAFMVLLIWVAIAIINVAYARRP
Ga0373959_0158535_234_3923300034820Rhizosphere SoilVATTITALGSVALGVAATAIVSSAGGLGGQGFIIVLIWLAIAIINVAYARHS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.