NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098177

Metagenome / Metatranscriptome Family F098177

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098177
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence MSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKPAGQQK
Number of Associated Samples 90
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.81 %
% of genes near scaffold ends (potentially truncated) 26.92 %
% of genes from short scaffolds (< 2000 bps) 82.69 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.154 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.192 % of family members)
Environment Ontology (ENVO) Unclassified
(32.692 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.192 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07369DUF1488 7.69
PF02798GST_N 5.77
PF00313CSD 2.88
PF07536HWE_HK 1.92
PF03401TctC 0.96
PF01177Asp_Glu_race 0.96
PF08546ApbA_C 0.96
PF02606LpxK 0.96
PF01402RHH_1 0.96
PF06042NTP_transf_6 0.96
PF13302Acetyltransf_3 0.96
PF01165Ribosomal_S21 0.96
PF02371Transposase_20 0.96
PF01717Meth_synt_2 0.96
PF04909Amidohydro_2 0.96
PF08125Mannitol_dh_C 0.96
PF02518HATPase_c 0.96
PF00487FA_desaturase 0.96
PF01841Transglut_core 0.96
PF02515CoA_transf_3 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3920Two-component sensor histidine kinase, HisKA and HATPase domainsSignal transduction mechanisms [T] 1.92
COG4251Bacteriophytochrome (light-regulated signal transduction histidine kinase)Signal transduction mechanisms [T] 1.92
COG0246Mannitol-1-phosphate/altronate dehydrogenasesCarbohydrate transport and metabolism [G] 0.96
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.96
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.96
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.96
COG1663Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase)Cell wall/membrane/envelope biogenesis [M] 0.96
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.96
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.96
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.96
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.96
COG3547TransposaseMobilome: prophages, transposons [X] 0.96
COG3575Uncharacterized conserved proteinFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.15 %
UnclassifiedrootN/A28.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT01DFRJ0Not Available596Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101668911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2884Open in IMG/M
3300000956|JGI10216J12902_106372356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5302Open in IMG/M
3300000956|JGI10216J12902_111065599All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300001661|JGI12053J15887_10180227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1087Open in IMG/M
3300001686|C688J18823_10463559Not Available815Open in IMG/M
3300002074|JGI24748J21848_1018445All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300002077|JGI24744J21845_10016025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1494Open in IMG/M
3300002245|JGIcombinedJ26739_101449845All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300002568|C688J35102_119132217Not Available643Open in IMG/M
3300002568|C688J35102_120162860All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300003324|soilH2_10229178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2591Open in IMG/M
3300004114|Ga0062593_100164192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1709Open in IMG/M
3300004153|Ga0063455_100058052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1370Open in IMG/M
3300004157|Ga0062590_100499262Not Available1036Open in IMG/M
3300004463|Ga0063356_100193613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2387Open in IMG/M
3300004479|Ga0062595_100807882All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300004479|Ga0062595_101932771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300004480|Ga0062592_100472732All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300004480|Ga0062592_100499928All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300004643|Ga0062591_100021885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3129Open in IMG/M
3300005093|Ga0062594_100089552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1786Open in IMG/M
3300005093|Ga0062594_103175838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.515Open in IMG/M
3300005338|Ga0068868_100766617All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005356|Ga0070674_101424950Not Available621Open in IMG/M
3300005367|Ga0070667_100496157All Organisms → cellular organisms → Bacteria → Proteobacteria1119Open in IMG/M
3300005511|Ga0077121_10404869Not Available952Open in IMG/M
3300005529|Ga0070741_10251159All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300005564|Ga0070664_100517422Not Available1101Open in IMG/M
3300005575|Ga0066702_10466104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium773Open in IMG/M
3300005587|Ga0066654_10412655All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005841|Ga0068863_102731248Not Available502Open in IMG/M
3300006038|Ga0075365_10520626Not Available841Open in IMG/M
3300006042|Ga0075368_10352058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.641Open in IMG/M
3300009143|Ga0099792_10488036All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300009174|Ga0105241_12184530Not Available549Open in IMG/M
3300009553|Ga0105249_11289774All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300009553|Ga0105249_13339033All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010045|Ga0126311_11653207Not Available540Open in IMG/M
3300010052|Ga0133944_1001186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales60665Open in IMG/M
3300010397|Ga0134124_11985400All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300010399|Ga0134127_13292174Not Available528Open in IMG/M
3300010400|Ga0134122_12308637Not Available584Open in IMG/M
3300012212|Ga0150985_114730412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium569Open in IMG/M
3300012212|Ga0150985_121963229All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300012469|Ga0150984_113876647Not Available597Open in IMG/M
3300012683|Ga0137398_10206993All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300012882|Ga0157304_1067675All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300012892|Ga0157294_10114486Not Available710Open in IMG/M
3300012896|Ga0157303_10045378Not Available878Open in IMG/M
3300012901|Ga0157288_10057335All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300012913|Ga0157298_10011441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1493Open in IMG/M
3300012924|Ga0137413_10229389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1264Open in IMG/M
3300012927|Ga0137416_10065573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2611Open in IMG/M
3300012930|Ga0137407_11404810All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012957|Ga0164303_11345773Not Available531Open in IMG/M
3300012958|Ga0164299_11005868Not Available615Open in IMG/M
3300013297|Ga0157378_12801958Not Available540Open in IMG/M
3300014325|Ga0163163_10678009All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300014968|Ga0157379_11046815Not Available780Open in IMG/M
3300015372|Ga0132256_100528704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1291Open in IMG/M
3300015372|Ga0132256_102914942All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300015373|Ga0132257_100847530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1143Open in IMG/M
3300015373|Ga0132257_103014066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.613Open in IMG/M
3300017792|Ga0163161_11728834All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300017965|Ga0190266_10516303Not Available700Open in IMG/M
3300018067|Ga0184611_1277316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria587Open in IMG/M
3300018073|Ga0184624_10314649Not Available701Open in IMG/M
3300018432|Ga0190275_10003292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11505Open in IMG/M
3300018432|Ga0190275_10005268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9309Open in IMG/M
3300018469|Ga0190270_10761929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales969Open in IMG/M
3300018469|Ga0190270_11022024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria854Open in IMG/M
3300018469|Ga0190270_12690646Not Available560Open in IMG/M
3300018476|Ga0190274_10699679All Organisms → cellular organisms → Bacteria → Proteobacteria1057Open in IMG/M
3300019361|Ga0173482_10007344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2683Open in IMG/M
3300019883|Ga0193725_1111844All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300019884|Ga0193741_1037488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1251Open in IMG/M
3300020005|Ga0193697_1092016All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300021170|Ga0210400_10583834All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300021363|Ga0193699_10029025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2062Open in IMG/M
3300022756|Ga0222622_10056813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2237Open in IMG/M
3300022883|Ga0247786_1131272Not Available556Open in IMG/M
3300023064|Ga0247801_1029822All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300024347|Ga0179591_1023853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2340Open in IMG/M
3300025899|Ga0207642_10043037All Organisms → cellular organisms → Bacteria → Proteobacteria1989Open in IMG/M
3300025930|Ga0207701_10237020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1595Open in IMG/M
3300025937|Ga0207669_11096034All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300025937|Ga0207669_11587292Not Available558Open in IMG/M
3300026078|Ga0207702_12145573All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300026088|Ga0207641_12495667Not Available515Open in IMG/M
3300026089|Ga0207648_11418156Not Available653Open in IMG/M
3300026863|Ga0209902_102680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4665Open in IMG/M
3300027266|Ga0209215_1059848Not Available532Open in IMG/M
3300027603|Ga0209331_1071412All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300027907|Ga0207428_10696663All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300028536|Ga0137415_10107297All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300028810|Ga0307294_10375228Not Available530Open in IMG/M
3300030988|Ga0308183_1192945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales526Open in IMG/M
3300031456|Ga0307513_10132765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2432Open in IMG/M
3300031720|Ga0307469_11672863All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300031720|Ga0307469_11770550Not Available596Open in IMG/M
3300032782|Ga0335082_10115082All Organisms → cellular organisms → Bacteria2647Open in IMG/M
3300033004|Ga0335084_10077958All Organisms → cellular organisms → Bacteria → Proteobacteria3435Open in IMG/M
3300034155|Ga0370498_015090All Organisms → cellular organisms → Bacteria1619Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
LiquidEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
CyanobacterialHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.96%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.96%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005511Combined assembly of arab plate scrape MF_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010052Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026863Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)Host-AssociatedOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_022087702170459016Switchgrass, Maize And Mischanthus LitterMSNENDKSVAPGTTKADPANNQPAPQQNQGGAKPGSNKPADQQK
INPhiseqgaiiFebDRAFT_10166891153300000364SoilMNTENQKPVAPGTTKVEPANAQPAPQQNQGDAKPSTEKPAGQQK*
JGI10216J12902_10637235643300000956SoilMSNENQKPVAPGTTKIDPAQTQQPVPQQNQGDNKPGTEKPAEQQK*
JGI10216J12902_11106559923300000956SoilMSNETQKPVAPGTTKVEPATAPAPQQNQGDVKPGTEKPADQQK*
JGI12053J15887_1018022713300001661Forest SoilMTNETEKPVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK*
C688J18823_1046355933300001686SoilMTNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK*
JGI24748J21848_101844523300002074Corn, Switchgrass And Miscanthus RhizosphereMSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDK
JGI24744J21845_1001602523300002077Corn, Switchgrass And Miscanthus RhizosphereMSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQXK*
JGIcombinedJ26739_10144984513300002245Forest SoilMKGFYLMTNETQKPVAPGTTKVEPAVSPAPQQNQGDAKPSADKPANQQQK*
C688J35102_11913221723300002568SoilMTNETQKPVAPGTTKVEPAAVQPAPQQNQGDAKPSTDKPAAQQK*
C688J35102_12016286023300002568SoilMSTENHNTVAPGTTKVEPANTHPAPQQNQGDAKPSTEKPASQQK*
soilH2_1022917843300003324Sugarcane Root And Bulk SoilMSNENQKPVAPGTTKTDPAQGQPAPQQNQGDNKAGADKPAGQQK*
Ga0062593_10016419223300004114SoilMSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQQK*
Ga0063455_10005805223300004153SoilMSTENQKPVAPGTTNVEPANTHPAPQQNQGDAKPSTEKPAGQQK*
Ga0062590_10049926233300004157SoilVSNENQKSVTPDTKVEPATAQPAPQQSQADAKPSTDQAAGQKK*
Ga0063356_10019361353300004463Arabidopsis Thaliana RhizosphereMSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGTDKPANQQQK*
Ga0062595_10080788223300004479SoilMSTENQKPVAPGTTKVEPANVQPAPQQNQGDAKPSTDKPAGQQK*
Ga0062595_10193277113300004479SoilENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSADKPASQQK*
Ga0062592_10047273213300004480SoilVSNENQKSVTPDTKVEPATAQPAPQQSQADAKPGTDQAAGQKK*
Ga0062592_10049992823300004480SoilMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK*
Ga0062591_10002188513300004643SoilENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0062594_10008955263300005093SoilMNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0062594_10317583823300005093SoilTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK*
Ga0068868_10076661713300005338Miscanthus RhizosphereMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0070674_10142495013300005356Miscanthus RhizosphereMSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPADQQK*
Ga0070667_10049615713300005367Switchgrass RhizosphereMTNETEKTVAPGTTKVEPAVTPTPQQNQGDAKPSADKPANQQQK*
Ga0077121_1040486923300005511Arabidopsis RhizosphereMTNETEKTVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK*
Ga0070741_1025115933300005529Surface SoilMSNENDKSVAPGTTKADPANNQPAPQQNQGGAKPGSNKPADQQK*
Ga0070664_10051742233300005564Corn RhizosphereAQGIHKMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0066702_1046610413300005575SoilMTNETQKPVAPGSTHVEPAKSPAPQQTQGDAKPSADKSAQQK*
Ga0066654_1041265523300005587SoilVSNENQKPVAPGTTKVEPATAQPAPQQNQGDAKPSTDKPAVQQK*
Ga0068863_10273124823300005841Switchgrass RhizosphereMNNENQKPVSADTTKVEPAKAQPQQNQGDGKPGTGKPAEQ
Ga0075365_1052062633300006038Populus EndosphereENQKPVAPGTTTVEPNKTTPAPQQNQGDAKPSTDKPAGQQK*
Ga0075368_1035205813300006042Populus EndosphereMSNENQKPVAPGTTTVEPNKTTPAPQQNQGDAKPSTDKPAGQQK*
Ga0099792_1048803623300009143Vadose Zone SoilMSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPSTDKPADQQK*
Ga0105241_1218453023300009174Corn RhizosphereMSNESQKNAPGTTKVDPANTQPPQQQNQGDGTPNSEKPANQQK*
Ga0105249_1128977423300009553Switchgrass RhizosphereMAYLENAFRSFHEGIYFMTNETEKTVAPGTTKVEPAVTPTPQQNQGDAKPSADKPANQQQK*
Ga0105249_1333903323300009553Switchgrass RhizosphereMSNETQKPVAHGTTTVEPANAQPAPQQNQGDSKPSTDKPAEQQK*
Ga0126311_1165320723300010045Serpentine SoilMSNEAQKPVAPGTTKVEPNAQPQQQNQGDAKPSTDKPDAQQK*
Ga0133944_1001186453300010052LiquidMSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK*
Ga0134124_1198540013300010397Terrestrial SoilMSTENQKPVAPGTTKVEPANTQPAPQQNQGDGKPSADKPASQ
Ga0134127_1329217413300010399Terrestrial SoilMLLGLFMKGFHHMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK*
Ga0134122_1230863723300010400Terrestrial SoilMSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPAGQQK*
Ga0150985_11473041223300012212Avena Fatua RhizosphereRVLVRSLMPNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK*
Ga0150985_12196322913300012212Avena Fatua RhizosphereMTNETQKPVAPGTTKVEPAAVQPAPQQNQGDAKTDKPAAQQK*
Ga0150984_11387664723300012469Avena Fatua RhizosphereYEGIYLMTNETQKPVAPGTTKIEPAVANPAPQQNQGDAKPSADKSANQQQK*
Ga0137398_1020699343300012683Vadose Zone SoilMSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPSTDK
Ga0157304_106767523300012882SoilMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQ
Ga0157294_1011448623300012892SoilMNNENQKPAAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0157303_1004537833300012896SoilFAQGIHKMNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK*
Ga0157288_1005733513300012901SoilHQKPVAPGTTKVEPATVQPTPQQNQGDSKPSTDKPAEQQK*
Ga0157298_1001144123300012913SoilMSNETQKPVAPGTTKVEPAAPQATPQQNQGDAKPSTDKPAEQQK*
Ga0137413_1022938913300012924Vadose Zone SoilMTNETEKPVAPGTTKVEPAVTPAPQQNQGDAKPAADKPANQQQK*
Ga0137416_1006557323300012927Vadose Zone SoilMTNETPTPVAPGTTKVEPAVTPAPQQNQGDAKPSADKPANQQQK*
Ga0137407_1140481023300012930Vadose Zone SoilMTNETPTPVAPGTTKVEPAATPTPQQNQGDAKPSADKPANQQQK*
Ga0164303_1134577313300012957SoilMTNEPQTSAPGTTKVDPANKQPPQQQNQGDGKPGSEKPANQQK*
Ga0164299_1100586823300012958SoilVSNENQKSVTPDTKVEPATAQPAPQQSHADAKPSTDQAAGQKK*
Ga0157378_1280195813300013297Miscanthus RhizosphereMTNENQKPAAPGTTRVEPVKSPVPQQTQGDAKPATEKPAGQQK*
Ga0163163_1067800913300014325Switchgrass RhizosphereMSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKPSTDKPAEQQK*
Ga0157379_1104681523300014968Switchgrass RhizosphereMFLGFSERIDAMSNENQKPVAPGTTKADPANAQPAPQHNQGNPKPGADKPGSQQK*
Ga0132256_10052870423300015372Arabidopsis RhizosphereMFLGLSRQGFIKMSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGTDKPANQQQK*
Ga0132256_10291494223300015372Arabidopsis RhizosphereMTNENQKPVAPGTSKVDPAQAQPAPQQNQGGSKPGTDKPAS
Ga0132257_10084753013300015373Arabidopsis RhizosphereMKMSNENQKPVAPGTTKVDPQAQPAPQQNQGDGKQGSDKPANQQQK*
Ga0132257_10301406613300015373Arabidopsis RhizosphereENQKPVAPETKVEPTTGQPAQQQNQGDAKQNADKSGGQQK*
Ga0163161_1172883423300017792Switchgrass RhizosphereMSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKQGTDKPASQ
Ga0190266_1051630313300017965SoilVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK
Ga0184611_127731613300018067Groundwater SedimentMTNETQKPVAPGTTKVEPTAQPTPQQNQGDAKPSTDKPADQQK
Ga0184624_1031464913300018073Groundwater SedimentMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTEKPAGQQK
Ga0190275_1000329273300018432SoilMSNENQKPVAPGTTKVDPAQTPQPAPQQTQGDSKPGADKPADQQK
Ga0190275_1000526833300018432SoilMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKPAGQQK
Ga0190270_1076192933300018469SoilMTNENQKPVAPGTTKVEPAHAQPATPQQNQGDSKPATEKPAEQQ
Ga0190270_1102202433300018469SoilMSNENQKPVAPGTTKVEPAHAQPATPQQNQGDSKPATEKPAEQQK
Ga0190270_1269064613300018469SoilMTTENQKPVAPGTTKVEPATAQPAPQQNQGDAKPSTEKPAGQQK
Ga0190274_1069967923300018476SoilMSTENQKPVAPGTTKVEPANTQPAPQQNQGDAKPSTDKSAGQQK
Ga0173482_1000734463300019361SoilMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK
Ga0193725_111184413300019883SoilMTNEAQKPVVAPGTTHVEPAKSPAPQQNQGDAKPSTDK
Ga0193741_103748823300019884SoilMTNETQKPVAPGTTKVEPANAQPAPQQNQGDAKPDSDKPAQQK
Ga0193697_109201623300020005SoilMTNETEKHVAPGTTKVEPAVTPTPQQSQGDAKPSADKPAEQQK
Ga0210400_1058383413300021170SoilMKGFCLMTNETLKPVAPGTTKVDPAITPAPQQNQGDAKPSADKPANQQQK
Ga0193699_1002902543300021363SoilMKGFYLMTNETPTPVAPGTTKVEPAVTPTPQQNQGDAKPAADKPANQQQK
Ga0222622_1005681363300022756Groundwater SedimentMSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTDKPAEQQK
Ga0247786_113127223300022883SoilMNSENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDKPANQQK
Ga0247801_102982213300023064SoilMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAG
Ga0179591_102385323300024347Vadose Zone SoilMTNETQKPVAPGTTKVEPAVTPTPQQNQGDAKPSADKPADQQQK
Ga0207642_1004303723300025899Miscanthus RhizosphereMSNETQKPVAPGTTKVEPANAPAPQQNQGDAKPNTDKPAGQQK
Ga0207701_1023702013300025930Corn, Switchgrass And Miscanthus RhizosphereMNNENQKPVAPGTTKTDPAQAQPAPQQNQGDNKAGNDK
Ga0207669_1109603423300025937Miscanthus RhizosphereMSTENQKPVAPGTTKVDPAQAQPAPQQNQGDSKQGTDKPASQQK
Ga0207669_1158729213300025937Miscanthus RhizosphereSFHEGIHQMSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPNTDKPAGQQK
Ga0207702_1214557313300026078Corn RhizosphereMSNEAQKSVAPGTTKVEPANTQTTPQQNQGGGKPDADKPSDQQK
Ga0207641_1249566723300026088Switchgrass RhizosphereMNNENQKPVSADTTKVEPAKAQPQQNQGDGKPGTGKPAEQQK
Ga0207648_1141815613300026089Miscanthus RhizosphereMSTENQKPVAPGTTKVEPANAPAPQQNQGDAKPSTDKPADQQK
Ga0209902_10268073300026863CyanobacterialMSNENQKPVAPTTKVDTAKTPSAPQQNQGDAKPSTEKPTVQQK
Ga0209215_105984823300027266Forest SoilMSNENQKPVAPGATEVDPAQTQQPAPQQTQGDSKPSTDKPAQQK
Ga0209331_107141213300027603Forest SoilMKGFYLMTNETQKPVAPGTTKVEPAVSPAPQQNQGDAKPSADKPANQQQK
Ga0207428_1069666313300027907Populus RhizosphereMSNETQKPVAPGTTKVEPANAQPAPQQNQGDSKPSTD
Ga0137415_1010729743300028536Vadose Zone SoilGISQMSTENQKPVAPGTTKVEPASAQPAPQQNQGDAKPRTDKPADQQK
Ga0307294_1037522813300028810SoilMTNEAQKPVAPGTTKVEPAAAQPAPQQNQGDAKPSTDKPAAQQK
Ga0308183_119294523300030988SoilMTNENQKSVAPGTTKVEPAVAQPAPQQNQGDAKPSTDKPAAQQK
Ga0307513_1013276513300031456EctomycorrhizaMTNETEKTVAPGTTKVEPAATPTPQQNQGDAKPSADKPANQQQK
Ga0307469_1167286323300031720Hardwood Forest SoilMTNETQKPVVAPGTTHVEPAKSPAPQQNQGDAKPSTEKPAGQQK
Ga0307469_1177055013300031720Hardwood Forest SoilMSNENQKPVAPGTTKSDPAQTQPAPQQSQGDSKPGVDKPTDQQK
Ga0335082_1011508263300032782SoilMSNENQKPAAPGTTKSGQASTQPPAQQNQGDAKSGSKPADQQK
Ga0335084_1007795833300033004SoilMSNENQKPVAPGTTKSGQANTQPPAQQNQGDAKSGSKPADQQK
Ga0370498_015090_1263_14003300034155Untreated Peat SoilMSNENQKPVAPGTTKVDPAQTPQPAPQQTQGDNKPSTDKPAEQQK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.