NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099598

Metagenome / Metatranscriptome Family F099598

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099598
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 48 residues
Representative Sequence GTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Number of Associated Samples 93
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.94 %
% of genes near scaffold ends (potentially truncated) 96.12 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.699 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.505 % of family members)
Environment Ontology (ENVO) Unclassified
(27.184 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.718 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF04417DUF501 80.58
PF02541Ppx-GppA 14.56
PF02803Thiolase_C 0.97
PF00535Glycos_transf_2 0.97
PF07690MFS_1 0.97
PF03167UDG 0.97
PF00578AhpC-TSA 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1507Uncharacterized conserved protein, DUF501 familyFunction unknown [S] 80.58
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 29.13
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.97
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.97
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.97
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.70 %
UnclassifiedrootN/A23.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01DKGL8All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
2199352024|deeps__Contig_177395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1064Open in IMG/M
2199352025|deepsgr__Contig_159680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1490Open in IMG/M
3300005167|Ga0066672_10838547Not Available575Open in IMG/M
3300005168|Ga0066809_10122974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata653Open in IMG/M
3300005179|Ga0066684_10942336Not Available561Open in IMG/M
3300005338|Ga0068868_100913577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia798Open in IMG/M
3300005339|Ga0070660_100256345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1427Open in IMG/M
3300005434|Ga0070709_10324784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1130Open in IMG/M
3300005435|Ga0070714_100173088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1960Open in IMG/M
3300005435|Ga0070714_100565660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1089Open in IMG/M
3300005436|Ga0070713_100783577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales913Open in IMG/M
3300005445|Ga0070708_101468279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata636Open in IMG/M
3300005467|Ga0070706_100149267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2182Open in IMG/M
3300005467|Ga0070706_101716681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium572Open in IMG/M
3300005518|Ga0070699_100285777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1478Open in IMG/M
3300005548|Ga0070665_102162503Not Available560Open in IMG/M
3300005598|Ga0066706_11131868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300005614|Ga0068856_102266406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300005615|Ga0070702_100031508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2903Open in IMG/M
3300005841|Ga0068863_100283865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata1604Open in IMG/M
3300006028|Ga0070717_10553771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1041Open in IMG/M
3300006028|Ga0070717_11398339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales635Open in IMG/M
3300006059|Ga0075017_101458355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata539Open in IMG/M
3300006176|Ga0070765_100299700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1485Open in IMG/M
3300006237|Ga0097621_101689728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata603Open in IMG/M
3300006806|Ga0079220_10351161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia938Open in IMG/M
3300006914|Ga0075436_101513664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales510Open in IMG/M
3300006954|Ga0079219_10842650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300006954|Ga0079219_10888851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales718Open in IMG/M
3300009101|Ga0105247_11634901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300010323|Ga0134086_10198029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300010366|Ga0126379_11598059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300010371|Ga0134125_12123022Not Available611Open in IMG/M
3300010373|Ga0134128_10845303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300010396|Ga0134126_10751948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300010396|Ga0134126_11857993Not Available660Open in IMG/M
3300010401|Ga0134121_12740195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300010869|Ga0126359_1716032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300010877|Ga0126356_10864293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300012200|Ga0137382_10768153Not Available692Open in IMG/M
3300012349|Ga0137387_10582899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300012359|Ga0137385_11375205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii569Open in IMG/M
3300012474|Ga0157356_1014461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii584Open in IMG/M
3300012925|Ga0137419_11275877Not Available617Open in IMG/M
3300012960|Ga0164301_10485758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300012989|Ga0164305_12098758Not Available518Open in IMG/M
3300014493|Ga0182016_10772258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii536Open in IMG/M
3300016270|Ga0182036_11366582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300016294|Ga0182041_11969513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300016357|Ga0182032_10333662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1208Open in IMG/M
3300017937|Ga0187809_10175374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300017947|Ga0187785_10530035Not Available592Open in IMG/M
3300017999|Ga0187767_10363222Not Available513Open in IMG/M
3300018025|Ga0187885_10509765Not Available536Open in IMG/M
3300020582|Ga0210395_10307897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300021374|Ga0213881_10575819Not Available512Open in IMG/M
3300021384|Ga0213876_10766161Not Available514Open in IMG/M
3300021475|Ga0210392_10370687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300021475|Ga0210392_10434515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300021478|Ga0210402_10416738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300021559|Ga0210409_10563906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300021559|Ga0210409_10790447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300024271|Ga0224564_1112009Not Available557Open in IMG/M
3300024283|Ga0247670_1021773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1148Open in IMG/M
3300024288|Ga0179589_10189004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae896Open in IMG/M
3300024288|Ga0179589_10238981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300025898|Ga0207692_10357987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300025908|Ga0207643_10093812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1753Open in IMG/M
3300025913|Ga0207695_10278460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata1567Open in IMG/M
3300025928|Ga0207700_11154036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300025938|Ga0207704_10235782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1364Open in IMG/M
3300025939|Ga0207665_10035970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae3290Open in IMG/M
3300026067|Ga0207678_10013774All Organisms → cellular organisms → Bacteria → Proteobacteria7105Open in IMG/M
3300026490|Ga0257153_1104143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300026552|Ga0209577_10778236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300027725|Ga0209178_1275500Not Available614Open in IMG/M
3300027787|Ga0209074_10193167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales760Open in IMG/M
3300028716|Ga0307311_10022302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1584Open in IMG/M
3300028801|Ga0302226_10126035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1125Open in IMG/M
3300030509|Ga0302183_10161413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300030524|Ga0311357_11383640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300031525|Ga0302326_11345063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia969Open in IMG/M
3300031640|Ga0318555_10674223Not Available559Open in IMG/M
3300031748|Ga0318492_10675241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300031754|Ga0307475_11469415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300031797|Ga0318550_10636616Not Available512Open in IMG/M
3300031893|Ga0318536_10439555Not Available658Open in IMG/M
3300031941|Ga0310912_11020672Not Available634Open in IMG/M
3300031942|Ga0310916_10720431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300031946|Ga0310910_11413561Not Available535Open in IMG/M
3300032009|Ga0318563_10478580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300032065|Ga0318513_10365810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii703Open in IMG/M
3300032205|Ga0307472_101694628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales624Open in IMG/M
3300032261|Ga0306920_102026811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300032770|Ga0335085_10087765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4061Open in IMG/M
3300032770|Ga0335085_11768506Not Available634Open in IMG/M
3300032783|Ga0335079_11791188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300032828|Ga0335080_10918533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300032892|Ga0335081_10850954Not Available1082Open in IMG/M
3300032893|Ga0335069_10082956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4090Open in IMG/M
3300032955|Ga0335076_11743738Not Available512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.94%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.97%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.97%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_38123802035918004SoilGSQPRISSAQTTKSGPAPWYDKLWRSVQQADASTAK
deeps_033042502199352024SoilMCFPGTRCYIVEGSQPRSARPRRPRQGPAPWYDKLWRSVQQADAGPESKAK
deepsgr_026479302199352025SoilSRTSTAQAAKPGPASWYDKLWRSVQQADAGPESKAK
Ga0066672_1083854713300005167SoilTCYIVTGGQSPASTARPSKPGPAPWYDKLWRSVQQADANPESTAK*
Ga0066809_1012297423300005168SoilEQLAREELNMCFPGTRCYIVEGSQPRPGPAQAARQGPAPWYDKLWRSVQQADANPESTAK
Ga0066684_1094233613300005179SoilCYIVEGGQPRISPAQAAAKPGPAPWYDKLWRSVQEADGDPAGAAK*
Ga0068868_10091357733300005338Miscanthus RhizosphereYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK*
Ga0070660_10025634513300005339Corn RhizosphereEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK*
Ga0070709_1032478433300005434Corn, Switchgrass And Miscanthus RhizosphereRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK*
Ga0070714_10017308813300005435Agricultural SoilGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK*
Ga0070714_10056566033300005435Agricultural SoilGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0070713_10078357733300005436Corn, Switchgrass And Miscanthus RhizosphereGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0070708_10146827923300005445Corn, Switchgrass And Miscanthus RhizosphereEQLARQELDMCFPGTRCYIVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR
Ga0070706_10014926713300005467Corn, Switchgrass And Miscanthus RhizosphereQELNMCFPGTRCYIVEGGQPRVSTAQAAKAGPAPWYDKLWRSVQQADANPESTAK*
Ga0070706_10171668123300005467Corn, Switchgrass And Miscanthus RhizosphereELNMCFPGTRCYIVEGSQPRPGTAQAAKQGPAPWYDKLWRSVQQADSNPESTAK*
Ga0070699_10028577733300005518Corn, Switchgrass And Miscanthus RhizosphereCYIVEGGQPRASTAQVAKQGPASWYDKLWRSVQQADANPESTAK*
Ga0070665_10216250313300005548Switchgrass RhizosphereTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0066706_1113186823300005598SoilPGTRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPESTAK*
Ga0068856_10226640613300005614Corn RhizospherePRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0070702_10003150853300005615Corn, Switchgrass And Miscanthus RhizosphereEQLARQELNMCYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0068863_10028386533300005841Switchgrass RhizosphereCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0070717_1055377113300006028Corn, Switchgrass And Miscanthus RhizosphereLNMCFPGTRCYIVEGGKPPTSTAQAAKRAPASWYDKLWRSVQQADANPESTAK*
Ga0070717_1139833913300006028Corn, Switchgrass And Miscanthus RhizosphereRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGRESKAK*
Ga0075017_10121415723300006059WatershedsEGGQPLISTARSPRPGSAPWYDKLWQSVQQADAMPSNPKSAGK*
Ga0075017_10145835523300006059WatershedsLARQELDMCFPGTRCYIVEGSQPRVSMAQAAKPGPAPWYDKLWRSVQQADANPESTAR*
Ga0070765_10029970013300006176SoilGTRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPGSTAK*
Ga0097621_10168972813300006237Miscanthus RhizosphereGSQPRVSPAQASEPGPAPWYDKLWRSVQQADASTAK*
Ga0079220_1035116113300006806Agricultural SoilLARQELNMCYPGTRCYVVEGSQPRIGTTQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR*
Ga0075436_10151366413300006914Populus RhizosphereIEQLARQELNMCYPGTRCYVVEGSQPRIGTTQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR*
Ga0079219_1084265013300006954Agricultural SoilQLDMCFPRTTCYIVTGGQSPASTARTPRPGPAPWYDKLWRSVQQADASQAK*
Ga0079219_1088885113300006954Agricultural SoilELNMCFPGTRCYIVEGSQPRPGPAQAAKQGPAPWYDKLWRSVQQADADQESTAK*
Ga0105247_1163490123300009101Switchgrass RhizosphereLNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0134086_1019802923300010323Grasslands SoilNMCYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADTGPESKAK*
Ga0126379_1159805933300010366Tropical Forest SoilASTAQAAKPGPAPWYDKLWRSVQQADANRESAAK*
Ga0134125_1212302223300010371Terrestrial SoilLNMCYPGTRCYVVEGSQPRIGTAQAAKVGPASWYDKLWRSVQQADAGPESKAK*
Ga0134128_1084530333300010373Terrestrial SoilEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0134126_1075194833300010396Terrestrial SoilCYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK*
Ga0134126_1185799323300010396Terrestrial SoilTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGRESKAK*
Ga0134121_1274019513300010401Terrestrial SoilSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0126359_171603213300010869Boreal Forest SoilMCFPRTTCYIVTGGQRQAGTAARAAKAGPAPWYDKLWQSVQQADANPKIAAK*
Ga0126356_1086429313300010877Boreal Forest SoilTCYIVTGGQRQASTAARAAKAGPAPWYDKLWQSVQQADANPKTPAK*
Ga0137382_1076815313300012200Vadose Zone SoilTRCYIVAGGRPRASTAQAAKAGSAPWYDKLWRSVQQADANPESTAK*
Ga0137387_1058289913300012349Vadose Zone SoilVEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK*
Ga0137385_1137520513300012359Vadose Zone SoilREELNMCFPGTRCYIVEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK*
Ga0157356_101446113300012474Unplanted SoilEELNMCFPGTRCYIVEGGHPRASTAQAAKQGPAPWYDKLWRSVQQADANPESTAK*
Ga0137419_1127587713300012925Vadose Zone SoilMCFPGTRCYIVEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK*
Ga0164301_1048575833300012960SoilELNMCYPGTRCYVVEGSQPRIGTVQAAKAGPAPWYDKLWRSVQQADAGPESKAK*
Ga0164305_1209875813300012989SoilNMCFPGTRCYIVEGGQRQSGATAQAATPGPAPWYDKLWHSVQQADGSAAR*
Ga0182016_1077225813300014493BogMCFPGTKCYIVEGGQPLVAAAPSSRPGLPSWYDKLWQSVQQADASRAK*
Ga0182036_1136658213300016270SoilMCFPGTRCYIVEGSRPQVSPAQAAKAGPAPWYDKLWRSVQQADAGPESAAK
Ga0182041_1196951323300016294SoilGSQPRVSPAQAAKSGPAPWYDKLWRSVQQADASTAK
Ga0182032_1033366233300016357SoilGDQPQASTAQAAKPGPAPWYDKLWRSVQQADANPESAAK
Ga0187809_1017537413300017937Freshwater SedimentIEQLARQELDMCFPGTRCYIVEGSLPSVSLAQAAERGPAPWYDKLWRSVQQADAGPESKA
Ga0187785_1053003523300017947Tropical PeatlandELDMCFPGTRCYIAEGSQPRLGPAPVVKAGPAPWYDKLWRSVQQADTGPQSAAK
Ga0187767_1036322223300017999Tropical PeatlandEGGQPVIGSTHPPRPGPAPWYDKLWRSVQQADANPKIPAK
Ga0187885_1050976523300018025PeatlandMCFPGTKCYVVEGGQPLAAAAPSSQPGLPPWYDKLWRSVQQADASPAK
Ga0210395_1030789713300020582SoilTRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPESKAK
Ga0213881_1057581923300021374Exposed RockSGQQAPGAARAARPGPAPWYDKLWRSVQQADAGPAR
Ga0213876_1076616113300021384Plant RootsGTRCYIVEGSGQQAPGAARAARPGPAPWYDKLWRSVQQADAGPAR
Ga0210392_1037068713300021475SoilLDMCFPGTRCYIVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR
Ga0210392_1043451533300021475SoilMCFPGAKCYIVEGGQPLAGPARSPRPGPAPWYDKLWRSVQQADANPRTPAK
Ga0210402_1041673813300021478SoilRTSPAQAAKPGPASWYDKLWRSVQQADANPESTAK
Ga0210409_1056390633300021559SoilIVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR
Ga0210409_1079044733300021559SoilQPRTGTAQAAKPGPASWYDKLWRSVQQADANPESTAK
Ga0224564_111200923300024271SoilTQCYIVEGGQSLISTAQAARRGPAPWYDKLWQSVQQADANPGTSKSPGK
Ga0247670_102177333300024283SoilSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0179589_1018900433300024288Vadose Zone SoilEQLARQELNMCFPGTRCYIVEGGQPRASAAQAAKQGPAPWYDKLWRSVQQADANPESTAK
Ga0179589_1023898113300024288Vadose Zone SoilEGGQPRTSTAQAAKPGSASWYDKLWRSVQQADANPESTAK
Ga0207692_1035798733300025898Corn, Switchgrass And Miscanthus RhizosphereYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK
Ga0207643_1009381213300025908Miscanthus RhizosphereARQELNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0207695_1027846033300025913Corn RhizosphereLNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK
Ga0207700_1115403613300025928Corn, Switchgrass And Miscanthus RhizosphereVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0207704_1023578233300025938Miscanthus RhizosphereGTRCYIVEGGQPRPSPAQAAKPGPASWYDKLWRSVQQADANPESTPK
Ga0207665_1003597053300025939Corn, Switchgrass And Miscanthus RhizosphereRQELNMCFPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0207678_1001377423300026067Corn RhizosphereMCFPRTTCYIVTGGQTQAGPAARAAKAGPAPWYDKLWRSVQQADAGPESKAK
Ga0257153_110414323300026490SoilGTRCYIVEGGQPRASTAQAAKAGPAPWYDKLWRSVQQADANAESTAK
Ga0209577_1077823623300026552SoilPRISPAQAAAKPGPAPWYDKLWRSVQEADGDPAGAAK
Ga0209178_127550023300027725Agricultural SoilYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR
Ga0209074_1019316713300027787Agricultural SoilIEQLARQELNMCFPGTRCYIVEGSQPRPGTAQAAKHGPAPWYDKLWRSVQQADANPESTA
Ga0307311_1002230213300028716SoilRQELNMCFPGTRCYIVEGGQPRASTAQAARQGPAPWYDKLWRSVQQADAGPESKAK
Ga0302226_1012603513300028801PalsaCFPGTKCYIVEGGQPLVAAAPSSRPGLPSWYDKLWQSVQQADASRAK
Ga0302183_1016141313300030509PalsaARQELDMCFPGTKCYIVEGGQPLVAAAPSSRPGPPSWYDKLWQSVQQADASRAK
Ga0311357_1138364023300030524PalsaRQELDMCFPGTKCYIVEGGQPVVAAAPSSRPGLPPWYDKLWRSVQQADASPAK
Ga0302326_1134506333300031525PalsaYIVEGRQTSISTARTPKPGPAPWYSKLWQSVQQADASPAK
Ga0318555_1067422313300031640SoilCYIVEGSQPRPGPAPAAKTGPAPWYDKLWRSVQQADGGRESMAK
Ga0318492_1067524113300031748SoilFPGTQCYIVEGGQPVVSPARPPRPGPAPWYDKLWRSVQQADANPKIPSK
Ga0307475_1146941513300031754Hardwood Forest SoilLNMCFPGTRCYIVEGGQPRTGTAQAAKPGPASWYDKLWRSVQQADANPESTAK
Ga0318550_1063661613300031797SoilEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADAGPESAAK
Ga0318536_1043955523300031893SoilIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK
Ga0310912_1102067213300031941SoilCYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASPASTAK
Ga0310916_1072043133300031942SoilEGDQPQASTAQAAKPGPAPWYDKLWRSVQQADANPESAAK
Ga0310910_1141356113300031946SoilFPGTRCYIVEGSRPQVSPAQAAKAGPAPWYDKLWRSVQQADASSASTAK
Ga0318563_1047858023300032009SoilQLARQELDMCFPGTQCYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK
Ga0318513_1036581013300032065SoilLARQELDMCFPGTQCYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK
Ga0307472_10169462813300032205Hardwood Forest SoilAQQELNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK
Ga0306920_10202681133300032261SoilQVSPAQAAKAGPAPWYDKLWRSVQQADAGPESAAK
Ga0335085_1008776553300032770SoilQELDMCLPGTRCYIVEGSQPRPGPAPAVKAGPAPWYDKLWRSVQRADAGRESTAK
Ga0335085_1176850623300032770SoilQELDMCLPGTRCYIVEGSQPRPGPAPAAKAGPAPWYDKLWRSVQRADAGRESTAK
Ga0335079_1179118823300032783SoilCYIVTGGQPLTSTARTPRPGPAPWYDKLWRSVQQADAAPKSPAK
Ga0335080_1091853333300032828SoilQPVIGATHPARPGPAPWYDKLWRSVQRADANPKIPAK
Ga0335081_1085095413300032892SoilGGQPVISASDPPRPGPAPWYDKLWRSVQQADANPEIPAK
Ga0335069_1008295613300032893SoilIVEGSQPQVSPTQPAKSGPAPWYDKLWRSVQQADASPASTAK
Ga0335076_1174373823300032955SoilQQARQELDMCFPGTQCYIVEGGQPVIGSTPAPRPGPAPWYDKLWRSVQQADANPKLPAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.