NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099690

Metagenome / Metatranscriptome Family F099690

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099690
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 141 residues
Representative Sequence MLRADGFLIVTIYEEYGDAESRIADPVMICDCGFKSRVLLTADQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAKDDMLRELGRRKKPFTARISREGRVTQVRIYESAEWKTIPITKKNPSNFYRKK
Number of Associated Samples 97
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.06 %
% of genes near scaffold ends (potentially truncated) 36.89 %
% of genes from short scaffolds (< 2000 bps) 63.11 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.058 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.709 % of family members)
Environment Ontology (ENVO) Unclassified
(25.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.340 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.86%    β-sheet: 16.67%    Coil/Unstructured: 52.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.88.1.1: Glutaminase/Asparaginased1o7ja_1o7j0.60324
c.106.1.1: SurE-liked1l5xa11l5x0.58714
c.106.1.0: automated matchesd2phja_2phj0.58186
c.2.1.0: automated matchesd5uzxa_5uzx0.57786
c.88.1.0: automated matchesd7cbra_7cbr0.57532


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF04255DUF433 41.75
PF01555N6_N4_Mtase 2.91
PF04471Mrr_cat 1.94
PF13561adh_short_C2 1.94
PF01850PIN 1.94
PF00905Transpeptidase 1.94
PF04011LemA 0.97
PF01144CoA_trans 0.97
PF13183Fer4_8 0.97
PF04343DUF488 0.97
PF14022DUF4238 0.97
PF01040UbiA 0.97
PF02371Transposase_20 0.97
PF10091Glycoamylase 0.97
PF02321OEP 0.97
PF00574CLP_protease 0.97
PF12762DDE_Tnp_IS1595 0.97
PF10282Lactonase 0.97
PF01553Acyltransferase 0.97
PF04465DUF499 0.97
PF12704MacB_PCD 0.97
PF13487HD_5 0.97
PF14684Tricorn_C1 0.97
PF13492GAF_3 0.97
PF01425Amidase 0.97
PF08245Mur_ligase_M 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 41.75
COG0863DNA modification methylaseReplication, recombination and repair [L] 2.91
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 2.91
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 2.91
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.94
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.94
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.94
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.97
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.97
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.97
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.97
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.97
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.97
COG3547TransposaseMobilome: prophages, transposons [X] 0.97
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.06 %
UnclassifiedrootN/A1.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10135787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4961Open in IMG/M
3300001087|JGI12677J13195_1013778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4557Open in IMG/M
3300003218|JGI26339J46600_10118472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4635Open in IMG/M
3300003219|JGI26341J46601_10082419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4959Open in IMG/M
3300004063|Ga0055483_10003694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3972Open in IMG/M
3300004080|Ga0062385_11254416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4509Open in IMG/M
3300004082|Ga0062384_100036325All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300004092|Ga0062389_102224645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4721Open in IMG/M
3300004479|Ga0062595_100555613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4880Open in IMG/M
3300005174|Ga0066680_10485003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4778Open in IMG/M
3300005471|Ga0070698_100023456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6451Open in IMG/M
3300005534|Ga0070735_10961961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4500Open in IMG/M
3300005541|Ga0070733_10001397All Organisms → cellular organisms → Bacteria18054Open in IMG/M
3300005542|Ga0070732_10426330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4801Open in IMG/M
3300005555|Ga0066692_10346464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4942Open in IMG/M
3300005557|Ga0066704_10135376All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300005598|Ga0066706_10734572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4783Open in IMG/M
3300006050|Ga0075028_100278510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4926Open in IMG/M
3300006052|Ga0075029_101182436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4533Open in IMG/M
3300006059|Ga0075017_101342512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4562Open in IMG/M
3300006174|Ga0075014_100431723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4724Open in IMG/M
3300006354|Ga0075021_10014006All Organisms → cellular organisms → Bacteria4404Open in IMG/M
3300006354|Ga0075021_10156648All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300006794|Ga0066658_10130363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41243Open in IMG/M
3300006796|Ga0066665_10866906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4703Open in IMG/M
3300006800|Ga0066660_10083535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42209Open in IMG/M
3300006804|Ga0079221_10893048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4651Open in IMG/M
3300006893|Ga0073928_10004355All Organisms → cellular organisms → Bacteria21070Open in IMG/M
3300009012|Ga0066710_100116062All Organisms → cellular organisms → Bacteria3631Open in IMG/M
3300009518|Ga0116128_1012711All Organisms → cellular organisms → Bacteria2978Open in IMG/M
3300009617|Ga0116123_1008504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_43831Open in IMG/M
3300009629|Ga0116119_1037015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41293Open in IMG/M
3300009634|Ga0116124_1129565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4707Open in IMG/M
3300009640|Ga0116126_1017614All Organisms → cellular organisms → Bacteria3218Open in IMG/M
3300009643|Ga0116110_1017840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42786Open in IMG/M
3300010379|Ga0136449_101227482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41177Open in IMG/M
3300010396|Ga0134126_12168672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4606Open in IMG/M
3300011270|Ga0137391_10127381All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300012203|Ga0137399_10680327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4866Open in IMG/M
3300012203|Ga0137399_11373129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4592Open in IMG/M
3300012685|Ga0137397_10150213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41725Open in IMG/M
3300012925|Ga0137419_11282615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4615Open in IMG/M
3300017925|Ga0187856_1005364All Organisms → cellular organisms → Bacteria8257Open in IMG/M
3300017938|Ga0187854_10049413All Organisms → cellular organisms → Bacteria2107Open in IMG/M
3300017941|Ga0187850_10059565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41939Open in IMG/M
3300017970|Ga0187783_10137854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41798Open in IMG/M
3300017970|Ga0187783_10246334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41307Open in IMG/M
3300017973|Ga0187780_10059044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42648Open in IMG/M
3300017973|Ga0187780_11227522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4550Open in IMG/M
3300017975|Ga0187782_10367075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41091Open in IMG/M
3300018020|Ga0187861_10350183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4625Open in IMG/M
3300018022|Ga0187864_10011787All Organisms → cellular organisms → Bacteria5796Open in IMG/M
3300018088|Ga0187771_10200530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41655Open in IMG/M
3300018090|Ga0187770_10255161All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300019082|Ga0187852_1155318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4968Open in IMG/M
3300021046|Ga0215015_10735736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4932Open in IMG/M
3300021171|Ga0210405_10430090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41038Open in IMG/M
3300021180|Ga0210396_10115231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42426Open in IMG/M
3300021407|Ga0210383_10015272All Organisms → cellular organisms → Bacteria → Proteobacteria6476Open in IMG/M
3300021420|Ga0210394_10804057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata821Open in IMG/M
3300021432|Ga0210384_10009743All Organisms → cellular organisms → Bacteria9871Open in IMG/M
3300021474|Ga0210390_10606121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4918Open in IMG/M
3300022557|Ga0212123_10006594All Organisms → cellular organisms → Bacteria19218Open in IMG/M
3300024290|Ga0247667_1003888All Organisms → cellular organisms → Bacteria3304Open in IMG/M
3300025419|Ga0208036_1045134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4768Open in IMG/M
3300025472|Ga0208692_1095794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4593Open in IMG/M
3300025496|Ga0208191_1007657All Organisms → cellular organisms → Bacteria3290Open in IMG/M
3300025507|Ga0208188_1010158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_43085Open in IMG/M
3300025952|Ga0210077_1010017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42131Open in IMG/M
3300026334|Ga0209377_1128221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41005Open in IMG/M
3300026532|Ga0209160_1196731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4783Open in IMG/M
3300026552|Ga0209577_10058718All Organisms → cellular organisms → Bacteria3222Open in IMG/M
3300026760|Ga0207630_106607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4561Open in IMG/M
3300027629|Ga0209422_1035833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41214Open in IMG/M
3300027635|Ga0209625_1062394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4833Open in IMG/M
3300027725|Ga0209178_1036899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41548Open in IMG/M
3300027737|Ga0209038_10076458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41005Open in IMG/M
3300027767|Ga0209655_10102748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4951Open in IMG/M
3300027812|Ga0209656_10008348All Organisms → cellular organisms → Bacteria6600Open in IMG/M
3300027829|Ga0209773_10120860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41086Open in IMG/M
3300027842|Ga0209580_10353434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4732Open in IMG/M
3300027854|Ga0209517_10033237All Organisms → cellular organisms → Bacteria4263Open in IMG/M
3300027894|Ga0209068_10035420All Organisms → cellular organisms → Bacteria2489Open in IMG/M
3300028047|Ga0209526_10095133Not Available2097Open in IMG/M
3300028138|Ga0247684_1004712All Organisms → cellular organisms → Bacteria2135Open in IMG/M
3300030940|Ga0265740_1051836All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrosa508Open in IMG/M
3300031234|Ga0302325_11251827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4981Open in IMG/M
3300031525|Ga0302326_12055353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4736Open in IMG/M
3300031576|Ga0247727_10355352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41209Open in IMG/M
3300031708|Ga0310686_105154298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4831Open in IMG/M
3300031708|Ga0310686_109000953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41431Open in IMG/M
3300031708|Ga0310686_113951836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41137Open in IMG/M
3300031753|Ga0307477_10013056All Organisms → cellular organisms → Bacteria → Acidobacteria5681Open in IMG/M
3300032061|Ga0315540_10391289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4559Open in IMG/M
3300032515|Ga0348332_10519547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4986Open in IMG/M
3300032770|Ga0335085_10086625All Organisms → cellular organisms → Bacteria4092Open in IMG/M
3300032805|Ga0335078_10108930All Organisms → cellular organisms → Bacteria3984Open in IMG/M
3300032828|Ga0335080_10090826All Organisms → cellular organisms → Bacteria3386Open in IMG/M
3300032895|Ga0335074_10071319All Organisms → cellular organisms → Bacteria → Acidobacteria4691Open in IMG/M
3300032896|Ga0335075_10021163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9570Open in IMG/M
3300032898|Ga0335072_10260634All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300034091|Ga0326724_0168685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_41335Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.91%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.94%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.97%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.97%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001087Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025472Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025952Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026760Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-B (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1013578723300000567Peatlands SoilLKSKKRSKITNGKQQPEEPPVFFLDRTFGRTELAAMLRSAKFLVVTLYDEYGDAESRIADPVMICDCGLKGRVLLTGDQDLAFTWAKEIAEAQIAVFVTTNNNEGPHQWGPRIIKAKQDILRELKRREKPFTARISTDGRITQVRVYDGTRWKAITIGRRNAPHVSKFKPSG*
JGI12677J13195_101377813300001087Forest SoilMLRAKNFQIVTIYEEFGDAESKIADPVMIEDCGFKNRVLLTGDQDLVYTWAKEIKDAGIAVFVTTNNNEGPKQWGPRIIAAHREILRELRRRQRPFTARISSEGRVSQVRIYDGTVWKPITITSKNPPHINKQKRVESDEA*
JGI26339J46600_1011847213300003218Bog Forest SoilLAAILRSAGFLVVTLYDEYGESESRIADPVIIYDCGFKNRVLLTGDQDLAYTWAKEIIEARIAVFITTDNNDGPKQWGPRIVSAKDEMIRELSRRPKPFIARISKDGCLTMVRVLEGSAWKTIHIPRKKPSKSRK
JGI26341J46601_1008241913300003219Bog Forest SoilLAAILRSAGFLVVTLYDEYGESESRIADPVIIYDCGFKNRVLLTGDQDLAYTWAKEIIEARIAVFITTDNNDGPKQWGPRIVSAKDEMIRELSRRPKPFIARISKDGCLTMVRVLEGSAWKTIHIPRKKPSKSRKD*
Ga0055483_1000369423300004063Natural And Restored WetlandsMLRSAGFLVVTLYDEYGEAESRIADPVMICDCGFKGRVLLTADQDLVSTWAREIAEAGIAVFVTTNNNEGPKQWGPRVIAAKQSIMRELARREKPFTARISAHGTVSQVRLHEAGKWRAISIGKKNPPHTNKYKPGS*
Ga0062385_1125441613300004080Bog Forest SoilEYGDDESKIADPVMISDCGLKGRTLLTGDQDLVSTWAKEIAEAGVAVFVTTNNDEGPKQWGPRIIRARQDILRELRRREKPFTARISTDGRITQVRIFDGAHWKVIAIGRKNPPHANKYKSKTRV*
Ga0062384_10003632523300004082Bog Forest SoilMAGMLRSAGLLIVTLYDEYGDDESKIADPVMISDCGLKGRTLLTGDQDLVSTWAKEIAEAGVAVFVTTNNDEGPKQWGPRIIRARQDILRELRRREKPFTARISTDGRITQVRIFDGAHWKVIAIGRKNPPHANKYKSKTRV*
Ga0062389_10222464513300004092Bog Forest SoilMLREAAFLLVTIFDEFGEAESKIADPVLIYDCGLKNRVLLTGDQDLIYTWAKEIIEANIAVFVTTDNNEGPKQWGPRIISAKPDMLRELSRRQKPFTARISRDGCVTQVREYEDGEWKTFTIKRKNTSNFYRKK*
Ga0062595_10055561323300004479SoilDAAFLLVTIHEEFGEAESKIADPALIYDCGHKNRVLLTGDQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAMPDMLRELSRRKKPFTARISREGCVTQVREYEDGQWKTFAIKKKNPSNFHKK*
Ga0066680_1048500313300005174SoilMLRPQGFVLFTMYDEFGDAESKIADPVMIHDCGLKNRVLLTGDQQLVRTWAKEIAEAKIAVFVVTDNNEGPKKWGPRIITAKREIMRELHRRQKPFTARISTEGHVTQVRLYEGGQWK
Ga0070698_10002345613300005471Corn, Switchgrass And Miscanthus RhizosphereLAAMLRRAGFQLVTIYEEYGEAESKIADPVFILDCGFKNRVVLTGDQDLVYTWAKEIIDAGIAVFVTTDNNEGPKQWGPRIISAKADMMRELHRRQKPFTANISRNGSVTLVRLYDGAQWKTITIKQKKASNFHRKK*
Ga0070735_1096196113300005534Surface SoilEDFIVWTLYDEYGDAEGKIADHVIIADCGFKGRVLLTGDQDLVFTWAKEIVEAKIAVFVTTSNNQGPKHWGPIMIKAKGDILRELRRREKPFTARISSEGRITQVRMHDGTQWKTMTIGRKNPPHVNRQK*
Ga0070733_10001397173300005541Surface SoilMLRQNEFIVITLFEEFGEAESKIADPAIIADCGFKNRVLLTGDQDLVYTWSKEIVQAEVAVFVTTDNNEGPKQWGPRIIAARSGILKELGRRKKPFTARISREGRVTQVRVYDGGKWKQFTIGKKNKPHGNRYKENFS*
Ga0070732_1042633023300005542Surface SoilMMLRSAGFQVVTIYEEYGNAESRIADPAIIQDCGFKGRVLLTGDQDLVYTWGKEIVDSGIAVFVTTDNNEGPKQWGPRIVSAMNDMIRELNRRQKPFTARISREGQITLVRIFDRGEWRSIPIRKKKPSNFYRKR*
Ga0066692_1034646433300005555SoilMLRADGFLIVTIYEEYGDAESRIADPVMICDCGFKSRVLLTADQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAKDDMLRELGRRKKPFTARISREGRVTQVRIYESAEWKTIPITKKNPSNFYRKK*
Ga0066704_1013537623300005557SoilMLRSAGFQLVTIYEEYGDAEGKIADPVFILDCGFKNRIVLTGDQDMVYNWAKEIVDAKIAVFVTTDNNEGPKQWGPRIIAAKADIMRELLRRPKPFTASISREGRVTLVRVYDGTQWKTIPIRKRSPSSFRRKK*
Ga0066706_1073457213300005598SoilLVTIYEEFGDAEAKIADPTFILDCGYKGRVVLTGDQDMVYTWAKEILEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIIRELRRRQRPFTANISREGCVSLVRIHDGTKWKTIPIRRKNPSNFERKK*
Ga0075028_10027851013300006050WatershedsLKSKKRLKITSGKPLLDEPPVFFLDRTFGRNELARILRDAQFNLVTIYEEFGDAEAKIVDPVMISDCGLKNRVLLTGDKDLIYTWAKEIAEARIAVFVTTDNNEGPKQWGPRILSAKDDMLRELRRRERPFTARISREGQVTQVRVYESAEWKTIPIRKKNPSNFYRKK*
Ga0075029_10118243623300006052WatershedsYGEAESRIADPVIIYDCGFKNRVLLTGDQDLAYTWTKEIIEARIAVFVTTDNNEGPTQWGPRIILARDQMIRELRRRTRPFIGRISKDGCLTVVKILEGSEWKTIHIPRKKRTA*
Ga0075017_10134251223300006059WatershedsSKIADPVMIQDCGLKNRVLLTGDQDLVYTWAKEILEARIAVFVTTDNNEGPKKWGPRIINAKRDILRELARRQKPFSARVSAEGRVTQVRIHDGTRWKSIAIERKNPRHEDRQKR*
Ga0075014_10043172323300006174WatershedsLAGMLRADGFLLVTIFEEFGDAESKIADPVMIQDCGLKNRVLLTGDQDLVYTWAKEILEARIAVFVTTDNNEGPKKWGPRIINAKRDILRELARRQKPFSARVSAEGRVTQVRIHDG
Ga0075021_1001400653300006354WatershedsLARILRDAQFNLVTIYEEFGDAEAKIVDPVMISDCGLKNRVLLTGDKDLIYTWAKEIAEARIAVFVTTDNNEGPKQWGPRILSAKDDMLRELRRRERPFTARISREGQVTQVRVYESAEWKTIPIRKKNPSNFYRKK*
Ga0075021_1015664813300006354WatershedsMMLRSAGFQVVTIYEEYGNAESRIADPAIIQDCGFKGRVLLTGDQDLVYTWGKEIVDSGIAVFVTTDNNEGPKQWGPRIVSAMNDMIRELNRRQKPFTARISREGQITLVRIFDRGEW
Ga0066658_1013036323300006794SoilMLRSAGFLLVTIYEEFGDAEAKIADPTFILDCGYKGRVVLTGDQDMVYTWAKEILEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIMRELRRRQKPFTANISRDGCVTIVRIYDGTEW
Ga0066665_1086690613300006796SoilMLRPAGFLLVTIYEEFGDAEAKIADPTFILDCGYKGRVVLTGDQDMVYTWAKEILEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIIRELRRRQRPFTANISREGCVSLVRIHDGTKWKTIPIRRKNPSNFERKK*
Ga0066660_1008353523300006800SoilMLRSAGFLLVTIYEEFGDAEAKIADPTFILDCGYKGRVVLTGDQDMVYTWAKEILEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIMRELRRRQKPFTANISRDGCVTLVRIYDGTEWKTIPIRRKKPSRFERKE*
Ga0079221_1089304813300006804Agricultural SoilLRSKKRSKITNGKQQLEESPIFLLDRTFGRNELANMLSLAGLLVVTLFDEYGEAESKIADPVMILDCGLKGRVLLTGDQDLEFTWAKEIIEARIAVFVTTNNNEGPTEWAPRIIQAQADILRELRRREKPFTARIGTDGRVTRIRLYDGLQWKTIGIGKKHGPHRSKYKPE*
Ga0073928_1000435553300006893Iron-Sulfur Acid SpringMLRDAAFLLVTIYDEFGEAESKIADPVLIYDCGLKNRVLLTGDQDLIYTWAKEIVDARIAVFVTTDNNEGPKQWGPRIISAKADILRELSRRKKPFTARISREGCITQVREYEDGQWKTFVVRKKNPSNFHRGK*
Ga0066710_10011606243300009012Grasslands SoilMLREAEFVVVTIYDEFGDAESKIADPVMVYDCGLKGRVLLTGDQDLVYTWAKEIVEAKIAVFVTTDNNEGPKHWGPRIISAQKDILRELARREKPFTARISREGLVTQVRTYERGEWKTIQVGKSSH
Ga0116128_101271133300009518PeatlandLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL*
Ga0116123_100850453300009617PeatlandEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL*
Ga0116119_103701533300009629PeatlandSKRRSKITSGEQQPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL*
Ga0116124_112956513300009634PeatlandLAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKSNQESSNPKE*
Ga0116126_101761423300009640PeatlandLAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL*
Ga0116110_101784033300009643PeatlandMLRGAAFQIVTLYEEFGDAESKIADPAIIADCGFKGRALLTGDQDLVYIWAKEIAEASIAVFVTTNNNEGPKQWGPRIIKAKRDILRELRRRQRPFTARISAEGRITQVRVFDGSQWKAITVSKKNVPHVNKYRESSDEKGI*
Ga0136449_10122748213300010379Peatlands SoilTGEQQPDEPPVFLLDRTFGRSELAGMLRGAAFQIVTLYEEFGDAESKIADPAIIADCGFKGRALLTGDQDLVYIWAKEIAEASIAVFVTTNNNEGPKQWGPRIIKAKRDILRELRRRQRPFTARISAEGRITQVRVFDGSQWKAITVSKKNVPHVNKYRESSDEKGI*
Ga0134126_1216867223300010396Terrestrial SoilSACFLIVTLFDEYGDAESKIADPVMIGGCGLKGHVLLTGDKDLETTWAKEIVDAGIAVFITTNNNEGPKQWAPRIIHAKSGILRELMRRGKPFTARIGTDARVTRVRVYEGSQWKIIEIGKKHGPHKSKYKHTK*
Ga0137391_1012738133300011270Vadose Zone SoilMLRPAGFQLVTIYEEFGDAEAKIADPVFILDCGYKGRVVLTGDQDMVYTWAKEIVEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIMRELRRRKKPFTASISRDGCVTLVRIYDGTQWKTIAIRKKNPSNYERKQKK*
Ga0137399_1068032713300012203Vadose Zone SoilMLRPAGFQLVTIYEEFGDAEAKIADPVFILDCGYKGRVVLTGDQDMVYTWAKEIVEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIMRELRRRKKPFTASISRDGCVTLVRIYDGTQWKTIAIRKKKPSNYERKRKK*
Ga0137399_1137312923300012203Vadose Zone SoilMLRLAGFLLVTIFEEYGEAESKIVDPVLILDCGFKNRVVLTGDQDMVYTWAKEIVDAGIAVFVTTDNNEGPKQWGPRIIAAKADILRELRRRQKPFTASISRDGQVTLVRVYDGMRWKAIPIKKKNPSNFKRK
Ga0137397_1015021313300012685Vadose Zone SoilMLRSAGFLLVTIYEEFGDAEAKIADPAFILDCGYKGRVVLTGDQDMVYTWAKEIVEAKIAVFVTTDNNEGPDKWGPRIIAAKEGIMRELRRRQKPFTASISKDGCVTLVRIHDGTKWKTIPIRRKKPSNFERKQ*
Ga0137419_1128261513300012925Vadose Zone SoilVFFLDRTFGRNELAAMLRLAGFLLVTIFEEYGEAESKIVDPVLILDCGFKNRVVLTGDQDMVYTWAKEIVDAGIAVFVTTDNNEGPKQWGPRIIAAKADILRELRRRQKPFTASISRDGQVTLVRVYDGMRWKAIPIKKKNPSNFKRKK*
Ga0187856_100536463300017925PeatlandLRSKRRSKITSGEQQPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0187854_1004941323300017938PeatlandLAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0187850_1005956523300017941PeatlandLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0187783_1013785433300017970Tropical PeatlandMLRAQDFTLTTVYEEFGDAESRISDPTIILNCGLKNRVLLTADQDMVYTYAKEIREAGIAVFVVTNNNEGPKQWGPRIIAARVSICRELRRRKKPFTARISKEGVVSQVRIYEGSRWRSIAIGRK
Ga0187783_1024633423300017970Tropical PeatlandKRSKITNGMQQQLEEPPVFLLDKNLGRTELAEMLRAAGLQIVTLYNEYGDAESKIADPVMILGCGLKGHVLLTADQDLVFTWAKEIAEAKIAVFVTTNNNEGPKQWGPRIVNAKADIFRELRRRTKPFTARIAAHGRITQVRLNDGTHWVTLTIGRKNPPHTSKYKRETDAESS
Ga0187780_1005904423300017973Tropical PeatlandMLRSAGFLIVTLYEEYGDAESRIADPVMICDCGLKGRVLLTADQELASLWAKEIIDAGIAVFVTTNNNEGPKQWGPRIIAARHSMMRELRRRKKPFTAKISPEGRVIQVRLPEAGQWKTIQIPKRNPPHANKYKK
Ga0187780_1122752213300017973Tropical PeatlandMLRSAGFLIVTLHDEYEDAESKIADPVMIAGCGLKGRVLLTADQDLVFTWAREIVDARIAVFVTTNNNEGPKKWGPRIINAKGQMLRELRRREKPFTAKISAEGRITQVRIYDGTQWKPITIGTKNAKHISKYRPS
Ga0187782_1036707533300017975Tropical PeatlandYDEFGDAESKIADPVMIADCGFKGRVLLTGDQDLVYAWAKEIAESRIAVFVTTNNNEGPKQWGPRIISAKRGIFRELLRRQRPFTARISAEGRVTQVRLYEGSKWKVITIAKKNLAHRNKYKESNLEKGTQSEFGY
Ga0187861_1035018313300018020PeatlandLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0187864_1001178753300018022PeatlandLRSKRRSKITSGEQQPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNERPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0187771_1020053023300018088Tropical PeatlandMLRTEGFQIVTLYDEFGDAESKIADPVMISDCGFKGRVLLTGDQELVYTWAKEIIEAKIAVFVTTDNNEGPKQWGPRIISARRDIVRELRRRRRPFTARISAEGRVTQVRLYEDGRWKVIAIAKKNPAHRNKYKTESNVEKGKQSEIGYS
Ga0187770_1025516123300018090Tropical PeatlandMLRSAGFLIVTLYEEYGDAESRIADPVMICDCGLKGRVLLTADQELPSLWAKEIVDAGIAVFVTTNNNEGPKQWGPRIIAARHSMMRELRRRKKPFTAKISPEGRVIQVRLPEAGQWKTIPIPKKNPPHANKYKKKPSSLRLFKCNGAVSDRPRARPEPKRMPK
Ga0187852_115531823300019082PeatlandLRLAGFQIVTLYDEFGDAEFKIADPVLIADCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPNEWAPRIISARRDILRELRRRQRPFTARISAQGRVTQVRLYDGGRWKAVTIAKKNPPHISKYKKKINTESP
Ga0210407_1087217913300020579SoilLAAMLRPAGFLLVTIYEEYGVAESKIADPVFILDCGFKNRVVLTGDQDMVYTWAKEIVDAGIAVFVTTDNNEGPKQWGPRIIAAKADMLRELRRRQKPFTASISRDGSRDSSEGI
Ga0215015_1073573613300021046SoilMLRPQGFVLFTMYDEFGDAESKIADPVMIRDCGLKNRVLLTGDQDLVRTWAKEILEARVAVFVITNNNEGPKQWGPRIIAAKQDMMRELHRREKPFTARISTEGRIIQVRIFDSGQWKTIRIGEKNPPHVSKYKKGTDSEST
Ga0210405_1043009023300021171SoilMLRSAGFLIATVHEEFGNADGQIADPTLIIDCGFKGRIMLTGDQAMVYAYSKEIVDSGIAVFVTTDNNEGPEKWGPRIIAAKDGIMRELRRRKKPFTASISKDGCVTLVRIYDGTEWKTIHIRKKHPSNFDRKK
Ga0210396_1011523113300021180SoilMLRPAGFLLVTIHEEFGDAEAKIADPAFILDCGYKGRVVLTGDQDMVYTWAKEIVEAGIAVFVTTDNNEGPDKWGPRIIAAKNDIMRELRRRQKPFTANISREGCVTMVRVYDGAVWKAIPVRKKNPSNFY
Ga0210383_1001527233300021407SoilLAGILRADGFLLVTIFEEFGEAESKIADPVMIQDCGLKNRVLLTGDKDLVYTWAKEILEAKIAVFVTTDNNEGPKRWGPRIVKAKREIFRELTRRPKPFTARISREGRVTQVRIYAGEQWKTIVIERKNPQHANRQKR
Ga0210394_1080405713300021420SoilQPDEPPIFFLDRTFGRNELAEMLRADGFLLFTIYEEFGEAESKIADPIVIQDCGLKKRVLLTGDQELVHTWAKEIAESKIAVFVTTNNNEGPKQWGPRIIHAKRDILRELSRRQVPFTARISTEGRVTQVRIHDGTQWKTITIGKRNPPHENRQKP
Ga0210384_1000974333300021432SoilMLRADGFLLFTIYEEFGEAESKIADPIVIQDCGLKKRVLLTGDQELVHTWAKEIAESKIAVFVTTNNNEGPKQWGPRIIHAKRDILRELSRRQVPFTARISTEGRVTQVRIHDGTQWKTITIGKRNPPHENRQKP
Ga0210390_1060612113300021474SoilLKSKKRSKITSGKLSPPDDSPVFFLDRTFGRNELAAILRPAGFTVVTIFEEFGEAEAKIADPVFILDCGFKDRVVLTGDQDMVFTYAKEIAEAGIAVFVTTNNNEGPDKWGPRIITAKAAIIRELNRRQKPFTASISKEGQITLVRVYDGAEWKTIPIRRRNPSN
Ga0212123_1000659423300022557Iron-Sulfur Acid SpringMLRDAAFLLVTIYDEFGEAESKIADPVLIYDCGLKNRVLLTGDQDLIYTWAKEIVDARIAVFVTTDNNEGPKQWGPRIISAKADILRELSRRKKPFTARISREGCITQVREYEDGQWKTFVVRKKNPSNFHRGK
Ga0247667_100388843300024290SoilMLRDAAFLLVTIHEEFGEAESKIADPALIYDCGHKNRVLLTGDQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAMPDMLRELSRRKKPFTARISREGCVTQVREYEDGQWKTFAIKKKNPSNFHKK
Ga0208036_104513423300025419PeatlandSKRRSKITSGEQQPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0208692_109579423300025472PeatlandEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKNPPHASKYRGKINLESSQL
Ga0208191_100765763300025496PeatlandLRSKRRSKITSGEQQPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEAKIAVFVTTNNNEGPKEWGPRIISARRDILRELHRRQRPFTARISAEGRVAQVRLYDGVRWKTITVAKKN
Ga0208188_101015833300025507PeatlandMLRGAAFQIVTLYEEFGDAESKIADPAIIADCGFKGRALLTGDQDLVYIWAKEIAEASIAVFVTTNNNEGPKQWGPRIIKAKRDILRELRRRQRPFTARISAEGRITQVRVFDGSQWKAITVSKKNVPHVNKYRESSDEKGI
Ga0210077_101001733300025952Natural And Restored WetlandsMLRAAGFLVVTLYDEYGDAESKIADPVMIYDCGFKGRVLLTADQDLVFTWAKEIVEAKIAVFVTTNNNEGPKQWGPRIIAAKKQMLKELGRRERPFVARIAREGRVNQVRVYHGGVWRTITIPKKNPQHVSKYRTETGKGQGPGQ
Ga0209377_112822123300026334SoilMLRADGFLIVTIYEEYGDAESRIADPVMICDCGFKSRVLLTADQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAKDDMLRELGRRKKPFTARISREGRVTQVRIYESAEWKTIPITKKNPSNFYRKK
Ga0209160_119673123300026532SoilMLRSAGFQLVTIYEEYGDAEGKIADPVFILDCGFKNRIVLTGDQDMVYNWAKEIVDAKIAVFVTTDNNEGPKQWGPRIIAAKADIMRELLRRPKPFTASISREGRVTLVRVYDGTQWKTIPIRKRSPSSFRRKK
Ga0209577_1005871843300026552SoilMLRSAGFLLVTIYEEFGDAEAKIADPTFILDCGYKGRVVLTGDQDMVYTWAKEILEAGIAVFVTTDNNEGPDKWGPRIIAAKDGIMRELRRRQKPFTANISRDGCVTLVRIYDGTEWKTIPIRRKKPSRFERKE
Ga0207630_10660713300026760SoilDAAFLLVTIHEEFGEAESKIADPALIYDCGHKNRVLLTGDQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAMPDMLRELSRRKKPFTARISREGCVTQVREYEDGQWKTFAIKKKNPSNFHKK
Ga0209422_103583323300027629Forest SoilMRRSAEFQIVTLFDEYGEAESRIADPVMIADCGFKNRVLLTGDRDLVHTWAKEIVDASIAVFVTTDNSEGPQQWGPRIIAAREGILHELRRRHKPFTATISREGSISQVRLYEGSRWKGIEIKKKSPSNFYRKK
Ga0209625_106239413300027635Forest SoilITSGKPLLDEPPVFFLDRTFGRNVLAKMPRSAEFQIVTLFDEYGEAESRITDPVMIADCGFKNRVLLTGDRDLVHTWAKEIVDASIAVFVTTDNSEGPQQWGPRIIAAREGILHELRRRHKPFTATISREGSISQVRLYEGSRWKGIEIKKKSPSNFYRKK
Ga0209178_103689913300027725Agricultural SoilTFGRNELANMLSLAGLLVVTLFDEYGEAESKIADPVMILDCGLKGRVLLTGDQDLEFTWAKEIIEARIAVFVTTNNNEGPTEWAPRIIQAQADILRELRRREKPFTARIGTDGRVTRIRLYDGLQWKTIGIGKKHGPHRSKYKPE
Ga0209038_1007645813300027737Bog Forest SoilMAGMLRSAGLLIVTLYDEYGDDESKIADPVMISDCGLKGRTLLTGDQDLVSTWAKEIAEAGVAVFVTTNNDEGPKQWGPRIIRARQDILRELRRREKPFTARISTDGRITQVRIFDGAHW
Ga0209655_1010274813300027767Bog Forest SoilMAGMLRSAGLLIVTLYDEYGDDESKIADPVMISDCGLKGRTLLTGDQDLVSTWAKEIAEAGVAVFVTTNNDEGPKQWGPRIIRARQDILRELRRREKPFTARISTDGRITQVRIFDGAHWKVIAIGRK
Ga0209656_1000834873300027812Bog Forest SoilLAAILRSAGFLVVTLYDEYGESESRIADPVIIYDCGFKNRVLLTGDQDLAYTWAKEIIEARIAVFITTDNNDGPKQWGPRIVSAKDEMIRELSRRPKPFIARISKDGCLTMVRVLEGSAWKTIHIPRKKPSKSRKD
Ga0209773_1012086023300027829Bog Forest SoilMAGMLRSAGLLIVTLYDEYGDDESKIADPVMISDCGLKGRTLLTGDQDLVSTWAKEIAEAGVAVFVTTNNDEGPKQWGPRIIRARQDILRELRRREKPFTARISTDGRITQVRIFDGAHWKVIAIGRKNPPHANKYKSKTRV
Ga0209580_1035343413300027842Surface SoilRTFGRTELAMMLRSAGFQVVTIYEEYGNAESRIADPAIIQDCGFKGRVLLTGDQDLVYTWGKEIVDSGIAVFVTTDNNEGPKQWGPRIVSAMNDMIRELNRRQKPFTARISREGQITLVRIFDRGEWRSIPIRKKKPSNFYRKR
Ga0209517_1003323753300027854Peatlands SoilMLRSAKFLVVTLYDEYGDAESRIADPVMICDCGLKGRVLLTGDQDLAFTWAKEIAEAQIAVFVTTNNNEGPHQWGPRIIKAKQDILRELKRREKPFTARISTDGRITQVRVYDGTRWKAITIGRRNAPHVSKFKPSG
Ga0209068_1003542013300027894WatershedsMMLRSAGFQVVTIYEEYGNAESRIADPAIIQDCGFKGRVLLTGDQDLVYTWGKEIVDSGIAVFVTTDNNEGPKQWGPRIVSAMNDMIRELNRRQKPFTARISREGQITLVRIFDRGEWRSIPIRKKK
Ga0209526_1009513313300028047Forest SoilLRLREFLLVTIYEEYGEAESKIIDPVMICDCGFKNRVLLTGDQDLVYTWSKEIVEAGIAVFVTTDNNEGPKQWGPRIISAKDDMLRELGRREKPFTARISREGQLTQVRVYESGEWKTIPIRKKNPSNFNKKR
Ga0247684_100471233300028138SoilGEAESKIADPALIYDCGHKNRVLLTGDQDLVYTWAKEIVEAGIAVFVTTDNNEGPKQWGPRIISAMPDMLRELSRRKKPFTARISREGCVTQVREYEDGQWKTFAIKKKNPSNFHKK
Ga0265740_105183613300030940SoilGKQRPEEPPIFFLDRTFGRNEMAGKLRSVGFLVVTLYDEYGDAESKIADPVMIYDCGLKGRVLLTGDQDLVSTWAKEIAEAGIAVFVTTNNNEGPKQWAPRLIRAKEDMLRELRRREKPFTARISADGRITQVRIFEGSHWKIIALGKKNPPHANKYKPKTPPKSSQS
Ga0302325_1125182713300031234PalsaMLRSKNFQLVTIYEEYGEAESKIADPVIIYDCGLKNRVLLTGDQDLVYTWAKEIVESGIAVFVTTDNNESPKQWGPRIIRAKSDMLRELRRREKPFTARISTEGRVTQVRIHDGAQWKAITIGKKNPPHVNKQKEAIADSSSLKIKPEHKDET
Ga0302326_1205535323300031525PalsaMATLLRGAGFQIVTLYDEYGDAESKIADPVMICDCGFKGRVLLTGDRELIFTWAKEIQEAAIAVFVTTDNNSGPKQWGPAIIRARSDILRELRRRDKPFTANIGTEGRVTQVRLYDGVEWKTIAVAKKNQPHQNKYKDKT
Ga0247727_1035535213300031576BiofilmLKSKRQSKNTIGKSQLDEPPFFFLDRTVGRYELAGMLRAEDFLLITLYEEFGEAESKIADPVMIANCGFKGRVLLTGDQDLIYSFAKEIAEAGIAVFVTSDNRQGPIHWGPRIIAAKSDIWRELRRRKKPFTAKISKEGRITQVRIYEGKEWKSITIGKKNPPHRNKQREEDIARSFDT
Ga0310686_10515429813300031708SoilMARMLRSVGLLVVTLYDEYGDAESKIADPVMICDCGLKGRILLTGDQDLVSTWAKEIAEAGIAVFVTTNNNEGPKQWGPRIIGARGDILRELRRREKPFTARISTDGRITQVRIFDGTRWKVIAIGRKNPPHASKYKPKTA
Ga0310686_10900095323300031708SoilMLRANGFLVVTLYDEYGEAESRIADPVIIYDCGFKNRVLLTGDQDLVYTWSKEIVEGGIAVFVTTDNNEGPKQWAPRIISARKDILRELRRRQKPFTARISTQGRVTQVRMHDGARWNTISVGKKNPPHVNKQKKSSR
Ga0310686_11395183623300031708SoilMAGMLRSVGFLIVTLYDEYGDDESKIADPVMIYDCGLKGRTLLTGDQDLVSTWAKEIAESGIAVFVTTNNNEGPKQWGPRIIRARGDMFRELQRRKKPFTARISADGCITQVRIFDGIHWKVIAIGRKNPPHANKYKLKSRA
Ga0307477_1001305683300031753Hardwood Forest SoilMLRAEDFIVWTLYDEYGDAEGRIADCGFKGRILLTGDKDLVFTWAKEIIDAKIAVFVTTSNNEGPKFWGPIIIKAKGDILRELRRRKKPFTARISAEGRITQVRVYDGRNWKTITIGPKNPPHVNKQK
Ga0315540_1039128923300032061Salt Marsh SedimentMLRRVGFQLVTHYEEYGQERSAIGDPAIIVDCGLKNRVLITGDQNMVYSYAKEITEARIAVFVTTDNNEGPDQWAPRIIKAEPDIRRELRRRRKPFTARISTAGRVTQVRTYVGGTWKTTQIG
Ga0348332_1051954713300032515Plant LitterMARMLRSVGLLVVTLYDEYGDAESKIADPVMICDCGLKGRILLTGDQDLVSTWAKEIAEAGIAVFVTTNNNEGPKQWGPRIIRARGDMFRELQRRKKPFTARISADGCITQVRIFDGIHWKVIAIGRKNPPHANKYKLKSRA
Ga0335085_1008662543300032770SoilMLREAAFLLVTIYEEFGEAESKIADPVLIFDCGLKSRVLLTGDQDLVYTWAKEIVEAKIAVFVTTDNNEGPKQWGPRIISAMPDMLRELSRRRKPFTARISREGCVTQVREYQDGQWKTFAIKKKHPSNFDRKK
Ga0335078_1010893043300032805SoilMLRSTKEFVVVTIYEEYGEAESKIADPVMILDCGFKNRILLTGDQDLVYTWAKEIADAGIAVFVTTDNNEGPAKWGPRIVAAKRDIMRELKRRRKPFTARISREGRVTQVRVYEGAKWKVITIGKRNPPHTNVQKRTAPDLI
Ga0335080_1009082633300032828SoilMLRGAGFLLVTMYEEYGEAESKIADPALIRDCGLKNRVLLTGDQDLVYTWAREILAAKIAVFVTTDNNEGPKQWGPRIIAARNDIWRELSRRPKPFTARISREGRVTQVRVHEKGQWESITIAAKRHLHVNRKKKS
Ga0335074_1007131933300032895SoilVAAVLRAAGFLIVTLYDEYGDAESKIADPVLIYDCGLKGRVLLTGDQDLVFTWAKEIAEARIAVFVTTNNNEGPKQWGPRIIAAQRDMVRELGRRTKPFTGRISTGGRITQVRLYEGTEWRTITIGKKNPPHTSKYKARPESA
Ga0335075_1002116363300032896SoilMLRAAGFLVVTLYDEYGEAESKIADPVLIYDCGLKGRVLLTGDQDLVFTWAKEIAEARIAVFVTTNNNEGPKQWGPRIIAAQRDMARELRRRVRPFTGRISVDGRITQVRLYEGATWKTVTIGKKNLPHVSKYKTRPESP
Ga0335072_1026063433300032898SoilMLRQADFVVVTHYDEYGDEGHKIADPVIIQDCGLKNRVLLTGDQDLVYTWAVEIREAGIAVFVTTDNNEGPEKWGPRIIAAKRDIWRELTRRAKPFTARISREGQVTQVRIFERGFWKAITISRKKSSQRQNED
Ga0326724_0168685_647_11983300034091Peat SoilLRSKKQSKITSGEQRPDEPPIFLLDRTFGRTELAGLLRPAGFQIVTLYDEFGDAEFKIADPVLITDCGFKGRVLLTGDQDLVFTWAKEIAEANIAVFVTTNNDEGPKEWGPRIIAAKRDILRELHRRQRPSTARISAEGRVTQVRLYEGGRWRIISVAKKNPPHTNKYRGKTNPESHSPAKDR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.