NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099701

Metagenome / Metatranscriptome Family F099701

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099701
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence DYKIIRPIAWRFQGDYVQTRFFGTTQNNIRLSTGIVLRF
Number of Associated Samples 95
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.12 %
% of genes from short scaffolds (< 2000 bps) 79.61 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.233 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.650 % of family members)
Environment Ontology (ENVO) Unclassified
(25.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.427 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.30%    β-sheet: 0.00%    Coil/Unstructured: 59.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13506Glyco_transf_21 24.27
PF00535Glycos_transf_2 22.33
PF13641Glyco_tranf_2_3 6.80
PF04055Radical_SAM 4.85
PF13505OMP_b-brl 3.88
PF04362Iron_traffic 3.88
PF013675_3_exonuc 1.94
PF07963N_methyl 1.94
PF02597ThiS 1.94
PF01156IU_nuc_hydro 0.97
PF05237Obsolete Pfam Family 0.97
PF09335SNARE_assoc 0.97
PF12146Hydrolase_4 0.97
PF03023MurJ 0.97
PF01135PCMT 0.97
PF05221AdoHcyase 0.97
PF13487HD_5 0.97
PF12850Metallophos_2 0.97
PF13365Trypsin_2 0.97
PF027395_3_exonuc_N 0.97
PF03551PadR 0.97
PF01661Macro 0.97
PF00899ThiF 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2924Fe-S cluster biosynthesis and repair protein YggXPosttranslational modification, protein turnover, chaperones [O] 7.77
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 2.91
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 1.94
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 1.94
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.97
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.97
COG0534Na+-driven multidrug efflux pump, DinF/NorM/MATE familyDefense mechanisms [V] 0.97
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.97
COG0728Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis)Cell wall/membrane/envelope biogenesis [M] 0.97
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.97
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.97
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.97
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.97
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.97
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.97
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.97
COG2244Membrane protein involved in the export of O-antigen and teichoic acidCell wall/membrane/envelope biogenesis [M] 0.97
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.97
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.97
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.23 %
UnclassifiedrootN/A7.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10024627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1565Open in IMG/M
3300001593|JGI12635J15846_10054313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3036Open in IMG/M
3300002245|JGIcombinedJ26739_100781203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae835Open in IMG/M
3300004091|Ga0062387_100503159All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300004091|Ga0062387_100691612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae745Open in IMG/M
3300004092|Ga0062389_104183882All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005554|Ga0066661_10062604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2156Open in IMG/M
3300005712|Ga0070764_10250977All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300006174|Ga0075014_100031408All Organisms → cellular organisms → Bacteria → Acidobacteria2147Open in IMG/M
3300006174|Ga0075014_100209354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae987Open in IMG/M
3300006174|Ga0075014_100232794All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300006800|Ga0066660_10440340All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300009522|Ga0116218_1337891All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009628|Ga0116125_1025184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1480Open in IMG/M
3300009633|Ga0116129_1025338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2024Open in IMG/M
3300009759|Ga0116101_1031794All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300009839|Ga0116223_10108789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1747Open in IMG/M
3300009839|Ga0116223_10322751All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300011120|Ga0150983_10553744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1119Open in IMG/M
3300012096|Ga0137389_11086416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4685Open in IMG/M
3300012203|Ga0137399_10750116All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300012353|Ga0137367_10325285All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300012362|Ga0137361_11629797All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012532|Ga0137373_11262751All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012944|Ga0137410_11837076All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300014155|Ga0181524_10469046All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300014200|Ga0181526_10826047All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300017823|Ga0187818_10393025Not Available615Open in IMG/M
3300017975|Ga0187782_10151059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1728Open in IMG/M
3300017975|Ga0187782_11068339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300018006|Ga0187804_10428104All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300018017|Ga0187872_10337576All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300018027|Ga0184605_10414684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300018037|Ga0187883_10755881All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300018040|Ga0187862_10627581Not Available634Open in IMG/M
3300018042|Ga0187871_10014462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5262Open in IMG/M
3300018044|Ga0187890_10058105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2293Open in IMG/M
3300018047|Ga0187859_10563528All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300018088|Ga0187771_10003493All Organisms → cellular organisms → Bacteria10968Open in IMG/M
3300018088|Ga0187771_10608392All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300018090|Ga0187770_11690425Not Available517Open in IMG/M
3300020580|Ga0210403_10980690All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300020581|Ga0210399_10787038All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300020581|Ga0210399_11067120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300020583|Ga0210401_10950295All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300021401|Ga0210393_10085103All Organisms → cellular organisms → Bacteria → Acidobacteria2507Open in IMG/M
3300021402|Ga0210385_10028144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3621Open in IMG/M
3300021403|Ga0210397_10743344All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300021433|Ga0210391_10504150All Organisms → cellular organisms → Bacteria → Acidobacteria950Open in IMG/M
3300021474|Ga0210390_10760470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300021477|Ga0210398_11236462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300021479|Ga0210410_10114954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2383Open in IMG/M
3300022727|Ga0224567_104019All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300022731|Ga0224563_1015393All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300023250|Ga0224544_1005930All Organisms → cellular organisms → Bacteria → Acidobacteria1643Open in IMG/M
3300023255|Ga0224547_1049352All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025434|Ga0208690_1014411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1481Open in IMG/M
3300025463|Ga0208193_1099507All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300026217|Ga0209871_1107891All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300026309|Ga0209055_1061114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui1594Open in IMG/M
3300026552|Ga0209577_10471609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae858Open in IMG/M
3300026557|Ga0179587_10121091All Organisms → cellular organisms → Bacteria → Acidobacteria1605Open in IMG/M
3300027173|Ga0208097_1039600All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300027370|Ga0209010_1067773All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300027590|Ga0209116_1012768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1692Open in IMG/M
3300027641|Ga0208827_1020104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2473Open in IMG/M
3300027738|Ga0208989_10041425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1599Open in IMG/M
3300027884|Ga0209275_10087884All Organisms → cellular organisms → Bacteria → Acidobacteria1569Open in IMG/M
3300028780|Ga0302225_10316514All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300028780|Ga0302225_10510663All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300028906|Ga0308309_10064360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2706Open in IMG/M
3300028909|Ga0302200_10428919All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300029945|Ga0311330_10598995Not Available867Open in IMG/M
3300029953|Ga0311343_10074680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4041Open in IMG/M
3300029955|Ga0311342_10522781All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300029999|Ga0311339_10806390All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300030007|Ga0311338_10732710All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300030011|Ga0302270_10521963All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300030659|Ga0316363_10428055All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300030706|Ga0310039_10292076All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300030739|Ga0302311_10757665All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300030746|Ga0302312_10212242All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300031028|Ga0302180_10457652All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300031090|Ga0265760_10114390All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300031236|Ga0302324_100363267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2180Open in IMG/M
3300031525|Ga0302326_11016514All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300031708|Ga0310686_106741045All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300031715|Ga0307476_10749114All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300031718|Ga0307474_10853093All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031823|Ga0307478_10023829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4349Open in IMG/M
3300031962|Ga0307479_10024039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5771Open in IMG/M
3300031996|Ga0308176_12054974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300032001|Ga0306922_11225321All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300032043|Ga0318556_10520407Not Available622Open in IMG/M
3300032160|Ga0311301_11459876All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300032205|Ga0307472_102264604All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300032893|Ga0335069_12489158All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300032895|Ga0335074_10214760All Organisms → cellular organisms → Bacteria2320Open in IMG/M
3300032954|Ga0335083_10019006All Organisms → cellular organisms → Bacteria7982Open in IMG/M
3300033004|Ga0335084_11777692All Organisms → cellular organisms → Bacteria604Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.85%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.91%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.94%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.97%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022727Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1002462733300001471Forest SoilLDYKIIRILAVRAEGDYVQTRFFNTTQNNFRLSTGLVFRF*
JGI12635J15846_1005431353300001593Forest SoilAHLSANNGVGSDTSFATGIGGGIDYKIIRPIAWRLQGDYVQTRFSGTQNNVRISTGIVLRF*
JGIcombinedJ26739_10078120313300002245Forest SoilGGGLDYRIIRPIAWRFEGDYVQTRFFGSTQNNVRLSTGIVLRF*
Ga0062387_10050315913300004091Bog Forest SoilGGVDYKIIRPIAVRVQGDYVQTRFFGATQNNLRLSTGIVFRF*
Ga0062387_10069161213300004091Bog Forest SoilGGLDYKIVRPIAWRFQGDYVRTRFFNRAENNVRLSTGIVFRF*
Ga0062389_10418388213300004092Bog Forest SoilYRIIRAIAWRVQGDYISTHLLFGAYQNNIRLSTGIVVRF*
Ga0066388_10161572723300005332Tropical Forest SoilQSVGLSQSDTSFAYALGGGIDYKLFAPIAWRFQGDLLQTRFFSNTQDNLRLSTGILLRF*
Ga0066661_1006260413300005554SoilGSSDTSFASALGGGIDYKLIPAVAWRLQGDYVQTRFFNTTQNNLQLATGIVIRF*
Ga0070764_1025097713300005712SoilIRPIAWRFQGDYVSTHLFGLYQNNIRLSTGVVVRF*
Ga0075014_10003140813300006174WatershedsIGGGIDYRIFRPIALRFEGDYLQTRFFGTTQNNVRLSTGIVFRF*
Ga0075014_10020935413300006174WatershedsSFSTAVGGSLDYRIIRPLAWRFEGDYVQNRFFGRTQNNLRISTGIVLRF*
Ga0075014_10023279423300006174WatershedsIVRPIAWRFQGDYVRTKFFSRTDNNLRLSTGIVFRF*
Ga0066660_1044034043300006800SoilIPAVAWRLQGDYVQTRFFNTTQNNLQLATGIVIRF*
Ga0116218_133789113300009522Peatlands SoilTAIGGGLDYRIFRPIALRFQGDYLQTRFFGTTHGNVRLSTGIVFRF*
Ga0116125_102518433300009628PeatlandVDYRILKPIAWRFQGDYVVTQFFGNTQSNVRVSTGLVLRF*
Ga0116129_102533843300009633PeatlandTSFASAIGGGLDYRIIKPIAWRFQADYVITQFFGNTQDNVRVSTGLVLRF*
Ga0116101_103179433300009759PeatlandGGGVDAKITRRIAWRFQGDYLRTQFFSARQDNGRFSTGPVFRF*
Ga0116223_1010878933300009839Peatlands SoilPLVAWRLEGDYVRTHFFGAGQNNYRLSTGIAFHF*
Ga0116223_1032275113300009839Peatlands SoilGGLDYRIFRPIALRFQGDYLQTRFFGTTHGNVRLSTGIVFRF*
Ga0150983_1055374413300011120Forest SoilKIIRPVAWRLQGDYVQTRFFGTTQNNVRISTGIVLRF*
Ga0137389_1108641623300012096Vadose Zone SoilVGGGLDYRIIRPIAVRFQGDYIQNRFFGGTQNNVRLSTGVVFRF*
Ga0137399_1075011623300012203Vadose Zone SoilIDYHLIPLVAWRLEGDYVQTRFFSAKQNNIRLSTGIVLRF*
Ga0137378_1094515513300012210Vadose Zone SoilSATGFSDSDISFATALGGGLDYKIVKGLAWRGQLDFLQTRFYSQTQNNVRFSTGLVLRF*
Ga0137367_1032528513300012353Vadose Zone SoilGGIDYHLVTLVAWRVQADYVQTRFFGFHQNNIQLSTGISIHF*
Ga0137361_1162979713300012362Vadose Zone SoilDYRIIRPIAVRFQGDYIQNRFFGGTQNNVRLSTGVVFRF*
Ga0137373_1126275123300012532Vadose Zone SoilAGTDTSFATAVGGGIDYHLVTLVAWRVQADYVQTRFFGFHQNNIQLSTGISIHF*
Ga0137410_1183707613300012944Vadose Zone SoilGGLDVKIIRPVAWRFQGDYIQTRFFDSTQNNVRLSTGIVLRF*
Ga0181524_1046904613300014155BogDYRLFRPIALRFEGDYVQTRFFSTTQGNARLSMGIVFRF*
Ga0181526_1082604713300014200BogRIFHPIALRFEGDYLETRFFGTTQNNVRLSTGIAFHF*
Ga0182008_1037008723300014497RhizosphereQSDTSLATSIGGGIDYKLFAPVAWRFQGDLLQTRFFSNTQNNLRLSTGIVLRF*
Ga0187818_1039302523300017823Freshwater SedimentGGGLDYRIIRPIAWRLQGDFVLTHFFAMYQSNVRISTGIVLRF
Ga0187782_1015105933300017975Tropical PeatlandLDYRIIRPVAWRFQFDYMHTNLYSVGQNNFRISTGPVLRF
Ga0187782_1106833923300017975Tropical PeatlandPVGDPSNTSFAVAFGGGVDYRIIRPVAWRFEGDYIQTRFFSATQNDIRISTGIVIRF
Ga0187804_1042810413300018006Freshwater SedimentVDYKIIRPIAWRFQGDYVRTKFFGQTDNNLRLSTGIVFRF
Ga0187872_1033757613300018017PeatlandYKVIRPIAWRFQGDYVETRYFGATQNDVRLSTGLVLRF
Ga0184605_1041468423300018027Groundwater SedimentGGIDYKLIPAIAWRFQGDWLQTRVLSNTQSNLRLSTGIVLRF
Ga0187883_1075588123300018037PeatlandSSDTSFAWALGGGVDYKLFRPLAWRLQFDYVQTRFFQNAQNNIRLSTGLVFRF
Ga0187862_1062758123300018040PeatlandAAGGGLDYRIIRPIAWRFQGDYVSTRLFGLYQNNIRLSTGIVVRF
Ga0187871_1001446273300018042PeatlandDYKIIRPIAWRFQGDYVQTRFFSATQNNVRLSTGIVLRF
Ga0187890_1005810513300018044PeatlandTSLVTTVGGGLDYKIVRILALRAEGDYVQTRFFSTTQNNFRLSTGIVFRF
Ga0187859_1056352813300018047PeatlandDYKIVRILALRAEADYVQTRFFSTTQNNFRLSTGIVFRF
Ga0187771_1000349383300018088Tropical PeatlandLLRLLAWRMQLDYVHTRFFGGKQNDARVSTGLVLRF
Ga0187771_1060839223300018088Tropical PeatlandFATALGVGFDYRLIPTVAWRFQGDYVHTRFFGTGQDNARLSTGIVFRF
Ga0187770_1169042533300018090Tropical PeatlandLARIVAWRFQGDYVRTRFFGTRQDNARLSTGIVLRF
Ga0210403_1098069013300020580SoilVRLIALRVQGDYVQTRFFGTTQNNVRVSTGIVFRF
Ga0210399_1078703823300020581SoilKIIRLIAVRVQGDYVQTRFFGATQNNLRISTGIVLRF
Ga0210399_1106712023300020581SoilTAIGGGLDYRIIRPVAWRFQGDYVETRFFGTTQNNVRLSTGIVLRF
Ga0210401_1095029523300020583SoilGGGLDYKIIRPIALRLQGDYVQTRFFGTTQNNVRVSTGIVFRF
Ga0210393_1008510353300021401SoilTAAGGGLDYRIIRPIAWRFQGDYVSTHLFGLYQNNIRLSTGVVVRF
Ga0210385_1002814463300021402SoilLDYKIIKPLAWRLQGDYVQTRFFGTTQNNVRLSTGIVFRF
Ga0210397_1074334423300021403SoilAIGGGLDYKIIRPLAWRFQGDYVQTRFFATTQNNVRISTGIVLRF
Ga0210391_1050415023300021433SoilYKIIKPLAWRFQGDYVQTRFFGSTQNNVRLSTGIVFRF
Ga0210390_1076047013300021474SoilTSFATAIGGGLDYRIIRPVAWRFQGDYVETRFFGTTQNNVRLSTGIVLHF
Ga0210398_1123646223300021477SoilLDYRIIRPVAWRFQGDYVETRFFGTTQNNVRLSTGIVLRF
Ga0210410_1011495413300021479SoilFATAIGGGLDYKIIRPLAWRFQGDYVHTRFFGTTQDNVRISTGIVLRF
Ga0224567_10401923300022727Plant LitterVGGGLDYKIIRPIAIRFQGDYVQTRFFDDTQNNLRLSTGIVLRF
Ga0224563_101539323300022731SoilLVTTVGGGLDYKIIRILALRAEGDYVQTRFFSTTQNNFRLSTGIVFRF
Ga0224544_100593013300023250SoilGGLDYKIIKPVAWRFQGDYVETRFFAASQNNVRISTGIVFRF
Ga0224547_104935213300023255SoilDYKIIKPIAWRFQGDYVQTRFFGATQNNVRLSTGIVVRF
Ga0208690_101441133300025434PeatlandVDYRILKPIAWRFQGDYVVTQFFGNTQSNVRVSTGLVLRF
Ga0208193_109950723300025463PeatlandAIGGGADYTITRRFGWRLQADYVRTQFFGNTQNNVRASTGLVVRF
Ga0209871_110789123300026217Permafrost SoilVRLIAWRVEGDYITTRFFNSTQNNLRLSTGIVVRF
Ga0209055_106111413300026309SoilGGSSDTSFASALGGGIDYKLIPAVAWRLQGDYVQTRFFNTTQNNLQLATGIVIRF
Ga0209577_1047160933300026552SoilDTSFASALGGGIDYKLIPAVAWRLQGDYVQTRFFNTTQNNLQLATGIVIRF
Ga0179587_1012109133300026557Vadose Zone SoilGGGIDYKIIRPIAWRFQGDYVQTRFFSTTQNNIRLSTGIVLRF
Ga0208097_103960013300027173Forest SoilFATAFGGGLDYRIVRAVALRFQADYVWTHFFGAHQDNARVSTGIVFRF
Ga0209010_106777323300027370Forest SoilASAIGGGLDYRIIKPIAWRFQADYVITQFFGNTQDNVRVSTGLVLRF
Ga0209116_101276813300027590Forest SoilGGGLDYKIIRPLAWRFQGDYVQTRFFSTTQNNVRLSTGLVLRF
Ga0208827_102010413300027641Peatlands SoilDYKIIRPVAWRFQGDYVRTSLFGATQNNVRISTGIVLRF
Ga0208989_1004142533300027738Forest SoilLGGGVDYHLIPLLSWRLEGDYVQTRFFSRTQNNVRISTGIVVRF
Ga0209275_1008788413300027884SoilGGGLDYKIIRILALRAEGDYVQTRFFSTTQNNFRLSTGIVFRF
Ga0302225_1031651423300028780PalsaIIRPVALRFEFDYLQTRLFGPTQNGVRFSTGIVFRF
Ga0302225_1051066313300028780PalsaDYKIIKPVAWRFQGDYVQTRFFGTSQNNVRISTGIVFRF
Ga0308309_1006436013300028906SoilYRLFRPFAWRLQGDYVQTRFLGETQNNVRISTGIVFRF
Ga0302200_1042891913300028909BogDYKIIKPLAWRFQGDYVQTRFFGTTQNNVRISTGIVLRF
Ga0311330_1059899523300029945BogSDTSFATAWGGGLDYKIIKPVAWRFQGDYVQTRFFGGTQNNVRISTGIVLHF
Ga0311343_1007468073300029953BogGGGLDYKIIRPIAWRFQGDYVQTRFFGATQNNIRLSTGIVVRF
Ga0311342_1052278113300029955BogDTSFAYALGGGLDYRLIKPIAWRFQGDYVSTQFFGTNQDNVRISTGLVLRF
Ga0311339_1080639013300029999PalsaDYKIIKPVAWRFQGDYVQTRFYGTTQNNIRISTGIVLRF
Ga0311338_1073271013300030007PalsaGVTTDTSFATALGGGIDYKIIKPIAWRVQGDYVQTRFFDTTQDNVRISTGIVLRF
Ga0302270_1052196323300030011BogGGGLDYRLIKPIAWRFQGDYVSTQFFGTNQDNVRISTGLVLRF
Ga0316363_1042805523300030659Peatlands SoilGGGIDYRIIRAVAWRFQGDYVQTRFFGTTQNNVRISTGIVLRF
Ga0310039_1029207613300030706Peatlands SoilIRPIAWRFQGDYVQTRFFGTTQNNVRLSTGIVLRF
Ga0302311_1075766513300030739PalsaDYKIIRPIAWRFQGDYVQTRFFGTTQNNIRLSTGIVLRF
Ga0302312_1021224213300030746PalsaGGLDYKIIKPIAWRLQGDYVQTRFFSATQNNVRISTGIVFRF
Ga0302180_1045765213300031028PalsaVGGGLDYKIIRIVAVRAEADYVQTRFFSTTQNDFRLSTGIVFRF
Ga0265760_1011439013300031090SoilDYKIIRPIALRLQGDYVQTRFFGTTQNNVRVSTGIVFRF
Ga0302324_10036326733300031236PalsaFATALGGGLDYRIIRPVAWRFQGDYVQTRFFGNTQNNVRISTGIVLRF
Ga0302326_1101651423300031525PalsaIARPLAWRFQGDYMQTKLFTTTQNNARLSTGIVVRF
Ga0310686_10674104513300031708SoilIDYKIIRPIAWRFQGDYVQTRFFGTTQNNLRLSTGIVFRF
Ga0307476_1074911413300031715Hardwood Forest SoilFATAIRGGIDYKIIRPVAWRFEGDYVQTRFFGTTQDNVRFTTGVVLRF
Ga0307474_1085309323300031718Hardwood Forest SoilFATAIGGGIDYKIIKPVALRFEGDYVHTSFFGEGQNNVRISTGIVVRF
Ga0307478_1002382913300031823Hardwood Forest SoilGLDYRIIRPIAWRFQGDYVSTHLFGLYQNNIRLSTGIVLRF
Ga0307479_1002403913300031962Hardwood Forest SoilYTIVRPVAWRLQGDYLRTKFFNRTDNNLRLSTGIVFRF
Ga0308176_1205497413300031996SoilGIDYKLFAPVAWRFQGDLLQTRFFSNTQNNLKLSTGIVLRF
Ga0306922_1122532123300032001SoilFSDSDTSFANLVGGGLDYKIIKGLAWRGQLDFMQTRFYSETQNNVRFSTGIVLRF
Ga0318556_1052040713300032043SoilSTFATVVGGGLDYRIVHGVAWRFQGDYLQTRFFSGRQDNARLSTGLVLNF
Ga0311301_1145987613300032160Peatlands SoilLFRPVAWRFQGDYVHTRFFGARQNNVRLSTGIVFRF
Ga0307472_10226460423300032205Hardwood Forest SoilIKIVAWRFQGDYVHSHVFNTAQNNVRLSTGIVLRF
Ga0335069_1248915823300032893SoilYRLFRPIAWRFQGDYVHTHFFGARQDNVRLSTGIVLRF
Ga0335074_1021476043300032895SoilLGGGLDYKIIRPVAWRFQGDYVQTRFFGTTQDNVRISTGIVLRF
Ga0335083_10019006133300032954SoilATAVGGGLDYRIIRPLAWRFQGDYVQTRFFDATQSNIQLSTGIVLRF
Ga0335084_1177769223300033004SoilYKFLKVLAWRLQGDYVHTDLFDVSQNNVRISTGIVVRF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.