NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099806

Metagenome / Metatranscriptome Family F099806

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099806
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 50 residues
Representative Sequence TVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL
Number of Associated Samples 98
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 99.03 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.592 % of family members)
Environment Ontology (ENVO) Unclassified
(36.893 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.951 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.92%    β-sheet: 19.23%    Coil/Unstructured: 53.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03401TctC 2.91
PF04355SmpA_OmlA 2.91
PF03992ABM 2.91
PF01475FUR 1.94
PF07690MFS_1 0.97
PF11842DUF3362 0.97
PF13458Peripla_BP_6 0.97
PF01343Peptidase_S49 0.97
PF01435Peptidase_M48 0.97
PF04191PEMT 0.97
PF00583Acetyltransf_1 0.97
PF13205Big_5 0.97
PF05598DUF772 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2913Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complexCell wall/membrane/envelope biogenesis [M] 2.91
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.91
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.94
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 1.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2007427000|2007485014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium741Open in IMG/M
3300002568|C688J35102_118674505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium584Open in IMG/M
3300004047|Ga0055499_10000076All Organisms → cellular organisms → Bacteria → Proteobacteria4117Open in IMG/M
3300004081|Ga0063454_100165969All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300004114|Ga0062593_100021163All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3442Open in IMG/M
3300004463|Ga0063356_101562754All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium980Open in IMG/M
3300004643|Ga0062591_101116521All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium761Open in IMG/M
3300005213|Ga0068998_10006343All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300005295|Ga0065707_11106262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes514Open in IMG/M
3300005329|Ga0070683_102350839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes511Open in IMG/M
3300005332|Ga0066388_102376578All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium961Open in IMG/M
3300005343|Ga0070687_100392144All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium908Open in IMG/M
3300005355|Ga0070671_100797991All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium822Open in IMG/M
3300005406|Ga0070703_10307028All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium663Open in IMG/M
3300005439|Ga0070711_100448061All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300005444|Ga0070694_101368722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium596Open in IMG/M
3300005457|Ga0070662_101446041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium593Open in IMG/M
3300005536|Ga0070697_101913022All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium531Open in IMG/M
3300005539|Ga0068853_102470630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium503Open in IMG/M
3300005546|Ga0070696_100296121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1238Open in IMG/M
3300005614|Ga0068856_100299291All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300005841|Ga0068863_102028679All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300006049|Ga0075417_10710538All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006172|Ga0075018_10382008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium712Open in IMG/M
3300006578|Ga0074059_10551431All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium626Open in IMG/M
3300006581|Ga0074048_13439320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium872Open in IMG/M
3300006604|Ga0074060_10749461All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium692Open in IMG/M
3300006880|Ga0075429_100370732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1253Open in IMG/M
3300006954|Ga0079219_11220335All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300007255|Ga0099791_10128125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1178Open in IMG/M
3300009137|Ga0066709_103472721All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium572Open in IMG/M
3300009162|Ga0075423_10058035All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales4000Open in IMG/M
3300010337|Ga0134062_10195812All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium919Open in IMG/M
3300010358|Ga0126370_10124015All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1837Open in IMG/M
3300010358|Ga0126370_11916559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300010362|Ga0126377_12748661All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium567Open in IMG/M
3300010362|Ga0126377_13110569All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium536Open in IMG/M
3300010366|Ga0126379_12242014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium647Open in IMG/M
3300010403|Ga0134123_10870265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium903Open in IMG/M
3300011119|Ga0105246_10423731All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1111Open in IMG/M
3300011433|Ga0137443_1270036All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium505Open in IMG/M
3300011444|Ga0137463_1020110All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2387Open in IMG/M
3300012166|Ga0137350_1035929All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium946Open in IMG/M
3300012179|Ga0137334_1063774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium799Open in IMG/M
3300012469|Ga0150984_108951203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium564Open in IMG/M
3300012498|Ga0157345_1049340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium531Open in IMG/M
3300012922|Ga0137394_11134637All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium646Open in IMG/M
3300012930|Ga0137407_10977407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium802Open in IMG/M
3300012957|Ga0164303_10580891All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium734Open in IMG/M
3300012958|Ga0164299_10401059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium881Open in IMG/M
3300012960|Ga0164301_11190451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium611Open in IMG/M
3300012971|Ga0126369_10690259All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1097Open in IMG/M
3300012984|Ga0164309_11813930All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium523Open in IMG/M
3300012989|Ga0164305_10666988All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium845Open in IMG/M
3300014302|Ga0075310_1057307All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium768Open in IMG/M
3300014326|Ga0157380_12584178All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium574Open in IMG/M
3300014968|Ga0157379_10892992All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium843Open in IMG/M
3300015245|Ga0137409_10848443All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium749Open in IMG/M
3300015371|Ga0132258_10468440All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium3144Open in IMG/M
3300019362|Ga0173479_10443368All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium639Open in IMG/M
3300019997|Ga0193711_1034466All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium629Open in IMG/M
3300021081|Ga0210379_10343235All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium656Open in IMG/M
3300024232|Ga0247664_1072574All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium794Open in IMG/M
3300024251|Ga0247679_1021957All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1082Open in IMG/M
3300025711|Ga0207696_1055435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1124Open in IMG/M
3300025908|Ga0207643_10740945All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium636Open in IMG/M
3300025923|Ga0207681_10026315All Organisms → cellular organisms → Bacteria → Proteobacteria3751Open in IMG/M
3300025936|Ga0207670_10537606All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium953Open in IMG/M
3300025940|Ga0207691_11152752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium644Open in IMG/M
3300025954|Ga0210135_1004863All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1135Open in IMG/M
3300025957|Ga0210089_1002664All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1638Open in IMG/M
3300025961|Ga0207712_12116744All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300025979|Ga0210078_1036744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium663Open in IMG/M
3300025981|Ga0207640_11279221All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium654Open in IMG/M
3300026035|Ga0207703_12331624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium511Open in IMG/M
3300026325|Ga0209152_10399742All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium539Open in IMG/M
3300026820|Ga0207603_101700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium803Open in IMG/M
3300027633|Ga0208988_1164357All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium529Open in IMG/M
3300027731|Ga0209592_1338326All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium510Open in IMG/M
3300027873|Ga0209814_10389430All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium612Open in IMG/M
3300027886|Ga0209486_11010555All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium559Open in IMG/M
3300028065|Ga0247685_1007644All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1334Open in IMG/M
3300028146|Ga0247682_1086094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium580Open in IMG/M
3300028802|Ga0307503_10255458All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium859Open in IMG/M
3300028802|Ga0307503_10473390All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium669Open in IMG/M
3300028809|Ga0247824_10206902All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1075Open in IMG/M
3300031184|Ga0307499_10314250All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium520Open in IMG/M
3300031199|Ga0307495_10028744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1005Open in IMG/M
3300031199|Ga0307495_10172391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium576Open in IMG/M
3300031226|Ga0307497_10077330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1242Open in IMG/M
3300031548|Ga0307408_102079738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium547Open in IMG/M
3300031716|Ga0310813_10872110All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium814Open in IMG/M
3300031720|Ga0307469_10269437All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1383Open in IMG/M
3300031720|Ga0307469_12294456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium526Open in IMG/M
3300031740|Ga0307468_102062368All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium548Open in IMG/M
3300031858|Ga0310892_10210050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1177Open in IMG/M
3300031903|Ga0307407_10734450All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium746Open in IMG/M
3300032012|Ga0310902_10076303All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300032180|Ga0307471_102673072All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium633Open in IMG/M
3300033004|Ga0335084_11067360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium811Open in IMG/M
3300033432|Ga0326729_1022216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1037Open in IMG/M
3300033550|Ga0247829_10233876All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1473Open in IMG/M
3300034659|Ga0314780_181162All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium539Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.97%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2007427000Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, TennesseeEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014302Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025954Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026820Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-A (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028065Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
20075034622007427000GroundwaterDGPSWTLSETRLFDANNGALVWTGVVDTRENDNLGAALTGYVGMIFDAMVRDRVL
C688J35102_11867450513300002568SoilTRLFDARNGALAWTGIVETKENDDIGAALTQYINLVFDAMVKDRVL*
Ga0055499_1000007673300004047Natural And Restored WetlandsTWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL*
Ga0063454_10016596913300004081SoilRLFDAKNGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL*
Ga0062593_10002116383300004114SoilSETRLFDARNGALAWTGVVDTRENDNLGEALTEYVDMIFDAMVSDRVL*
Ga0063356_10156275413300004463Arabidopsis Thaliana RhizosphereTGPSWTVSETRLFDAKSGVLAWTGVVDTREHDDLGAALTQYMKVIFDAMVDDRVL*
Ga0062591_10111652123300004643SoilRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL*
Ga0068998_1000634343300005213Natural And Restored WetlandsTRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL*
Ga0065707_1110626223300005295Switchgrass RhizosphereEQTITGQTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL*
Ga0070683_10235083923300005329Corn RhizosphereFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL*
Ga0066388_10237657813300005332Tropical Forest SoilDAKNGALAWTGVMDTREYDDLGAALTQYIDVVFDAMVRDRVL*
Ga0070687_10039214423300005343Switchgrass RhizosphereTAPQQINGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL*
Ga0070671_10079799123300005355Switchgrass RhizosphereTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL*
Ga0070703_1030702823300005406Corn, Switchgrass And Miscanthus RhizosphereWTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL*
Ga0070711_10044806133300005439Corn, Switchgrass And Miscanthus RhizosphereTGPKYTLTETRLFDAKDGTLAWTGVVNTRESDDLNAALTQYIDIIFDAMVSDRVL*
Ga0070694_10136872223300005444Corn, Switchgrass And Miscanthus RhizosphereGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL*
Ga0070662_10144604113300005457Corn RhizosphereTGPTWTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL*
Ga0070697_10191302223300005536Corn, Switchgrass And Miscanthus RhizosphereLFDAKNGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL*
Ga0068853_10247063023300005539Corn RhizosphereTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL*
Ga0070696_10029612113300005546Corn, Switchgrass And Miscanthus RhizosphereAQKISGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL*
Ga0068856_10029929113300005614Corn RhizosphereTGPTWTLTETRLFDAKNGELAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL*
Ga0068863_10202867913300005841Switchgrass RhizosphereTWTLAETRLFDAKSGVLAWTGVVDTRKTDDVGGALTEFIDVIFDAMVSGHVL*
Ga0075417_1071053823300006049Populus RhizosphereSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL*
Ga0075018_1038200813300006172WatershedsTLAWTGVMDTRENDDLGAALTQYLDVIFDAMVRDRVL*
Ga0074059_1055143113300006578SoilGALAWTGVMDTRENDDLGAALTQYIEVIFDAMVNDRVL*
Ga0074048_1343932023300006581SoilQTVTGQTWTVSETRLFDAKSGALAWTGLVDTRQNDKLDAAMTQYINVIFDAMVGDKVL*
Ga0074060_1074946123300006604SoilSETRLFDAKSGALAWTGIMDTRENDDISAVLTQYIDVIFDAMVGDRVL*
Ga0075429_10037073213300006880Populus RhizosphereTATVPARQETIASWTLSETRLFDASNGALAWTGIVDTRENDDLGATLAQYLEVIFGAMVDDRVL*
Ga0079219_1122033513300006954Agricultural SoilTAPQQISGPSWTLSETRLFDARNGALAWTGIVDTKENDDLGAALTEYVNIIFDAMVRDRVL*
Ga0099791_1012812533300007255Vadose Zone SoilSETRLFDAKNGALAWTGLMDTKQNDKLDASMTQYINVIFDAMVGDKVL*
Ga0066709_10347272113300009137Grasslands SoilGPLWTLSETRLFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVSDRVL*
Ga0075423_1005803563300009162Populus RhizosphereWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL*
Ga0134062_1019581233300010337Grasslands SoilPQKITGPTWTLSETRLFDAKSGVLAWSGVVDTRKSDNAGEALTDYVNIIFEAMVGDRVL*
Ga0126370_1012401533300010358Tropical Forest SoilAKNGVLAWTGVMDTRENDDLGAALTQYINVVFEAMVRDRVL*
Ga0126370_1191655923300010358Tropical Forest SoilVNLPPQQVTGPSWTVSETRLFDAKNGALAWMGVVDTREYDDLGAALTQYIDVVFDAMVRDRVL*
Ga0126377_1274866123300010362Tropical Forest SoilPQQVNGPSWTVSETRLFDAKNGVLAWTGVMETRENDDLNAALTQYIEVVFDAMVRDRVL*
Ga0126377_1311056923300010362Tropical Forest SoilFDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI*
Ga0126379_1224201413300010366Tropical Forest SoilWTGVMETRENDDLNAALTQYIEVVFDAMVRDRVL*
Ga0134123_1087026513300010403Terrestrial SoilKSGVLAWTGVVDTRKTDDVGAALTEFVHVIFDAMVSGRVL*
Ga0105246_1042373113300011119Miscanthus RhizosphereNGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL*
Ga0137443_127003613300011433SoilIGPQWTVSETRLFDARNGALAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI*
Ga0137463_102011013300011444SoilPSWTVSETRLFDAKSGVLAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL*
Ga0137350_103592913300012166SoilQWTVSETRLFDARNGALAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI*
Ga0137334_106377423300012179SoilPSWTVSETRLFDAKSGVLAWTGVVDTREHDELGAALTQYMKVIFDAMVDDRVL*
Ga0150984_10895120323300012469Avena Fatua RhizosphereLFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVKDRVL*
Ga0157345_104934023300012498Arabidopsis RhizosphereWTVSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL*
Ga0137394_1113463723300012922Vadose Zone SoilTGPSWTVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL*
Ga0137407_1097740723300012930Vadose Zone SoilAWTGVMDTRENDNLGAALTQYIDVIFDAMVSDRVL*
Ga0164303_1058089113300012957SoilLAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL*
Ga0164299_1040105923300012958SoilSETRLFDAKNGVLAWTGLVDTPENDDLDAVLTQYVNLIFDAMVNDRIL*
Ga0164301_1119045123300012960SoilTGTLAWTGIVDTKENDNLGAALTQYVNIIFDAMVRDRVL*
Ga0126369_1069025913300012971Tropical Forest SoilKNGVLAWTGVMDTREYDDLGAALTQYIDVVFDAMVRDRVL*
Ga0164309_1181393023300012984SoilAPEKITGPSWTVSETRLFDTRNGALAWTGVMDTRENDDLGAALTQYIEVIFDAMVSDRVL
Ga0164305_1066698823300012989SoilAKNGVLAWTGLVDTPENDDLDAVLTQYVNLIFDAMVNDRIL*
Ga0075310_105730713300014302Natural And Restored WetlandsRLFDAKTGTLAWTGIVETRPGDGLDAALTQYIDVIFDAMVSDRVL*
Ga0157380_1258417823300014326Switchgrass RhizosphereSETRLFDAKNGALAWTGLVDTRNNNDIGAALTQYVGIIFDAMVSDRVL*
Ga0157379_1089299213300014968Switchgrass RhizosphereTGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL*
Ga0137409_1084844323300015245Vadose Zone SoilSWTVSETRLFDARNGVLAWTGIVDTRENHDFAAVLTQYIEVIFDAMVGDRVL*
Ga0132258_1046844043300015371Arabidopsis RhizosphereQINGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL*
Ga0173479_1044336823300019362SoilWQTVNTPAQKISGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL
Ga0193711_103446613300019997SoilSAQKVTGPSWTVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL
Ga0210379_1034323513300021081Groundwater SedimentLAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI
Ga0247664_107257423300024232SoilRLFDAKNGELAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL
Ga0247679_102195733300024251SoilPAQQISGPTWTLTETRLFDAKNGDLAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL
Ga0207696_105543533300025711Switchgrass RhizosphereWTVSETRLFDAKNGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL
Ga0207643_1074094523300025908Miscanthus RhizosphereTPAQTVTGPTWTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRV
Ga0207681_1002631563300025923Switchgrass RhizosphereLAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL
Ga0207670_1053760623300025936Switchgrass RhizospherePTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL
Ga0207691_1115275223300025940Miscanthus RhizosphereSAQTVTGPSWTLSETRLFDAKSGVPAWTGIVDSPESNDLDGALTQYINIIFDAMVQDRVL
Ga0210135_100486313300025954Natural And Restored WetlandsPTWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL
Ga0210089_100266413300025957Natural And Restored WetlandsTTPEQKISGPTWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL
Ga0207712_1211674423300025961Switchgrass RhizosphereSETRLFDAKSGVLAWTGVVDTQEHDDLGAALTQYMKVIFDAMVKDRVL
Ga0210078_103674423300025979Natural And Restored WetlandsSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL
Ga0207640_1127922113300025981Corn RhizosphereSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL
Ga0207703_1233162413300026035Switchgrass RhizosphereFDAKTGSLAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL
Ga0209152_1039974223300026325SoilPLWTLSETRLFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVSDRVL
Ga0207603_10170023300026820SoilKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVADKVL
Ga0208988_116435713300027633Forest SoilPSWTVSETRLFDAKNGVLAWTGVMDTRENDDLSAALTQYIDVIFDAMVSDRVL
Ga0209592_133832613300027731Freshwater SedimentKTGMLAWTGIVETRKSDGLDAALTQYIDVIFDAMVSDRVL
Ga0209814_1038943013300027873Populus RhizosphereVSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL
Ga0209486_1101055523300027886Agricultural SoilRLFDAKNGALAWTGLVDTRNNDDIGAALTEYVNIIFDAMVTDRVL
Ga0247685_100764433300028065SoilWETVSVPPQTITGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL
Ga0247682_108609413300028146SoilPQTITGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL
Ga0307503_1025545823300028802SoilTVTETRLFDAKNGALAWTGVMESRETDKLDAALTQYIEVIFDAMVGDRVL
Ga0307503_1047339023300028802SoilKWTASETRLFDASNGALAWTGVVDTRESDDFAAALSQYINVIFDAMVNDRVL
Ga0247824_1020690233300028809SoilARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL
Ga0307499_1031425023300031184SoilIGPKWTASETRLFDARSGALAWTGVVDTRESDSFASALTEYINVIFDAMVNDRVL
Ga0307495_1002874423300031199SoilTVSIPAQTVTGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL
Ga0307495_1017239113300031199SoilRSGALAWTGVVDTRESDSFAAALTQYIDVIFDAMVNDRVL
Ga0307497_1007733013300031226SoilTVSLSSQTITGPSMTVSETRLFDAKSGALAWTGMVDTKENDDFGAALTQYINVIFDAMVSDRVL
Ga0307408_10207973823300031548RhizospherePAWTVSETRLFDAKSGALAWTGVMDTRQHDDLGAALTQYMKVIFDAMVDDRVL
Ga0310813_1087211013300031716SoilGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYINMVFDAMVGDRVL
Ga0307469_1026943733300031720Hardwood Forest SoilTVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL
Ga0307469_1229445613300031720Hardwood Forest SoilARTGALAWTGIVDTKENDDLGAALTEYVNIIFDAMVRDRVL
Ga0307468_10206236813300031740Hardwood Forest SoilWTMSETRLFDAKNGVLAWTGIVDTKENDDLGAALKQYIDTVFDAMVSDRVL
Ga0310892_1021005013300031858SoilNGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL
Ga0307407_1073445013300031903RhizosphereQQFSGPSWTVSETRLFDAKSGTLAWTGIVDTRENERLDAALTQYIGVIFDAMVGDRML
Ga0310902_1007630333300032012SoilGPQWTVSETRLFDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI
Ga0307471_10267307213300032180Hardwood Forest SoilFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL
Ga0335084_1106736023300033004SoilLFDAKNGVLAWTGVMDTRETDDLSTALTQYVNVIFDAMVSDRVL
Ga0326729_102221613300033432Peat SoilTVSETRLFDAKNGVLAWTGVMDTRENDDLSAALTQYVNVIFDAMVNDRVL
Ga0247829_1023387613300033550SoilTVSETRLFDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI
Ga0314780_181162_407_5383300034659SoilFDAKTGALAWTGLVDTKQNEKLDASMTQYINVIFDAMVGDKVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.