NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099928

Metagenome / Metatranscriptome Family F099928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099928
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 53 residues
Representative Sequence MPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Number of Associated Samples 82
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.58 %
% of genes near scaffold ends (potentially truncated) 35.92 %
% of genes from short scaffolds (< 2000 bps) 85.44 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.961 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(18.447 % of family members)
Environment Ontology (ENVO) Unclassified
(26.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.485 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 57.41%    β-sheet: 0.00%    Coil/Unstructured: 42.59%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01068DNA_ligase_A_M 10.68
PF07238PilZ 1.94
PF13683rve_3 1.94
PF00072Response_reg 0.97
PF09939DUF2171 0.97
PF03118RNA_pol_A_CTD 0.97
PF01656CbiA 0.97
PF12327FtsZ_C 0.97
PF01272GreA_GreB 0.97
PF13795HupE_UreJ_2 0.97
PF08502LeuA_dimer 0.97
PF04828GFA 0.97
PF01841Transglut_core 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 10.68
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 10.68
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.97
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.97
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.97
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.96 %
UnclassifiedrootN/A32.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101D554UNot Available508Open in IMG/M
3300001867|JGI12627J18819_10039659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1961Open in IMG/M
3300001867|JGI12627J18819_10081536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1342Open in IMG/M
3300002245|JGIcombinedJ26739_100916034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi759Open in IMG/M
3300003505|JGIcombinedJ51221_10058861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1476Open in IMG/M
3300005167|Ga0066672_10257577Not Available1124Open in IMG/M
3300005167|Ga0066672_10405758Not Available892Open in IMG/M
3300005171|Ga0066677_10026227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2746Open in IMG/M
3300005171|Ga0066677_10688341Not Available573Open in IMG/M
3300005175|Ga0066673_10137916Not Available1347Open in IMG/M
3300005177|Ga0066690_10650439Not Available702Open in IMG/M
3300005184|Ga0066671_10213920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1167Open in IMG/M
3300005434|Ga0070709_10003383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8567Open in IMG/M
3300005434|Ga0070709_10531373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium897Open in IMG/M
3300005434|Ga0070709_11498701Not Available548Open in IMG/M
3300005436|Ga0070713_100293285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1495Open in IMG/M
3300005436|Ga0070713_101371065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300005437|Ga0070710_10042467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2514Open in IMG/M
3300005437|Ga0070710_10058121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2193Open in IMG/M
3300005454|Ga0066687_10058113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1830Open in IMG/M
3300005454|Ga0066687_10148765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1236Open in IMG/M
3300005454|Ga0066687_10217747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1051Open in IMG/M
3300005471|Ga0070698_100957439Not Available802Open in IMG/M
3300005543|Ga0070672_101770424Not Available555Open in IMG/M
3300005545|Ga0070695_101840630Not Available508Open in IMG/M
3300005554|Ga0066661_10193653Not Available1257Open in IMG/M
3300005554|Ga0066661_10385764Not Available858Open in IMG/M
3300005561|Ga0066699_10668040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales743Open in IMG/M
3300005575|Ga0066702_10386299Not Available853Open in IMG/M
3300005587|Ga0066654_10401027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii748Open in IMG/M
3300005764|Ga0066903_101450673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1292Open in IMG/M
3300006034|Ga0066656_10163943All Organisms → cellular organisms → Bacteria → Proteobacteria1397Open in IMG/M
3300006163|Ga0070715_10003754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4892Open in IMG/M
3300006163|Ga0070715_10243341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium936Open in IMG/M
3300006163|Ga0070715_10865661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300006173|Ga0070716_100918647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300006173|Ga0070716_101410656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300006175|Ga0070712_101170539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae668Open in IMG/M
3300006175|Ga0070712_101602355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300006800|Ga0066660_10471546Not Available1052Open in IMG/M
3300006800|Ga0066660_11284773Not Available573Open in IMG/M
3300006800|Ga0066660_11424197Not Available544Open in IMG/M
3300007076|Ga0075435_100068242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2896Open in IMG/M
3300009011|Ga0105251_10266827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium773Open in IMG/M
3300009148|Ga0105243_12773726Not Available530Open in IMG/M
3300010326|Ga0134065_10268917Not Available642Open in IMG/M
3300010401|Ga0134121_12334064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300011119|Ga0105246_10978992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium764Open in IMG/M
3300011119|Ga0105246_11289002Not Available676Open in IMG/M
3300012198|Ga0137364_10042970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2970Open in IMG/M
3300012200|Ga0137382_10198198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae1378Open in IMG/M
3300012202|Ga0137363_10407025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831134Open in IMG/M
3300012205|Ga0137362_10814387Not Available800Open in IMG/M
3300012208|Ga0137376_10073258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2856Open in IMG/M
3300012211|Ga0137377_11528283Not Available593Open in IMG/M
3300012357|Ga0137384_10767765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium781Open in IMG/M
3300012361|Ga0137360_10392706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1168Open in IMG/M
3300012958|Ga0164299_10584580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium760Open in IMG/M
3300012960|Ga0164301_11505761Not Available554Open in IMG/M
3300012975|Ga0134110_10232666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii781Open in IMG/M
3300012986|Ga0164304_10803153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300012989|Ga0164305_10610657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria878Open in IMG/M
3300013296|Ga0157374_12125856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300013308|Ga0157375_12202318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300014969|Ga0157376_13116244Not Available502Open in IMG/M
3300015372|Ga0132256_103483578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300016341|Ga0182035_10034366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3308Open in IMG/M
3300018433|Ga0066667_10194837Not Available1482Open in IMG/M
3300018468|Ga0066662_12024463Not Available603Open in IMG/M
3300018482|Ga0066669_10073678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2268Open in IMG/M
3300018482|Ga0066669_10247779Not Available1406Open in IMG/M
3300018482|Ga0066669_10964596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium768Open in IMG/M
3300021171|Ga0210405_10000318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium67665Open in IMG/M
3300021401|Ga0210393_10341449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1218Open in IMG/M
3300021420|Ga0210394_10636423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi937Open in IMG/M
3300021433|Ga0210391_10327415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1202Open in IMG/M
3300021478|Ga0210402_10059516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3355Open in IMG/M
3300021861|Ga0213853_10902326Not Available502Open in IMG/M
3300022522|Ga0242659_1042798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium779Open in IMG/M
3300022529|Ga0242668_1060533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300022709|Ga0222756_1048912Not Available629Open in IMG/M
3300025898|Ga0207692_11029467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300025910|Ga0207684_10329836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1315Open in IMG/M
3300025916|Ga0207663_11630361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae519Open in IMG/M
3300025929|Ga0207664_11331064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300025936|Ga0207670_10190202Not Available1553Open in IMG/M
3300026295|Ga0209234_1068271Not Available1352Open in IMG/M
3300026295|Ga0209234_1230016Not Available611Open in IMG/M
3300026312|Ga0209153_1000363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium22417Open in IMG/M
3300027326|Ga0209731_1018464Not Available960Open in IMG/M
3300027548|Ga0209523_1002064Not Available2954Open in IMG/M
3300031128|Ga0170823_14469421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria774Open in IMG/M
3300031231|Ga0170824_123071895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300031474|Ga0170818_111574387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium715Open in IMG/M
3300031474|Ga0170818_112899131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium643Open in IMG/M
3300031545|Ga0318541_10170640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1199Open in IMG/M
3300031715|Ga0307476_10830443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium683Open in IMG/M
3300031718|Ga0307474_10095282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2223Open in IMG/M
3300031753|Ga0307477_10334290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1043Open in IMG/M
3300031754|Ga0307475_10767675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria766Open in IMG/M
3300031942|Ga0310916_11251329All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300032059|Ga0318533_10128545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1778Open in IMG/M
3300032261|Ga0306920_102454000All Organisms → cellular organisms → Bacteria718Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere18.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_064310702189573001Grass SoilMPALIDLWLMPARLWLDLVAPLKLAPITTVDFVPLAKARYIRRRRKVLRSKRGD
JGI12627J18819_1003965913300001867Forest SoilMPALIDLWLMPARLWLDLVAPLKLAPLATDVVPLAKARYIRRKRKVLRSKRGD*
JGI12627J18819_1008153653300001867Forest SoilMPALIDLWLMPARLWLDLVAPLKVAPLATNVVLLAKARYIRRKRKVLRSKRGD*
JGIcombinedJ26739_10091603423300002245Forest SoilMPALIDLWLMPARLWLDLVAPLRLAPVTTNVVPFAKARYIRRRRKVLRSKRGD*
JGIcombinedJ51221_1005886133300003505Forest SoilMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0066672_1025757713300005167SoilMPALIDLWLMPARLWFDLVAPHKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD*
Ga0066672_1040575823300005167SoilMPALIDLWLMPTRLWLDLVAPPKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD*
Ga0066677_1002622753300005171SoilMPALIDFWLMPARLWLDLVAPFKLAPVTIDLVPLAKARYIRRRRKVLRSKRGD*
Ga0066677_1068834123300005171SoilMPALIDLWLMPARLWFDLVAPHKLAPVTTDLVPLAKARYIRRRRKVL
Ga0066673_1013791633300005175SoilMPALIDLWLMPARLWLDVVAPLKLAPVATDLVPLAKARYIRRRHKVLRSKRGD*
Ga0066690_1065043913300005177SoilWLMPARLWFDLVAPHKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD*
Ga0066671_1021392023300005184SoilALIDLWLMPARLWLDLVAPLKLAPVGTNVVSFAKARYIRRRHKVLRSKRGD*
Ga0070709_1000338333300005434Corn, Switchgrass And Miscanthus RhizosphereMSALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARHIRRRRKVLRSKRGD*
Ga0070709_1053137313300005434Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVTVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070709_1149870113300005434Corn, Switchgrass And Miscanthus RhizosphereMPAMIDFWLMPARFWLDLVAPLKLAPMTTNVVPFAKARYIRRRRKVLRSKRGD*
Ga0070713_10029328523300005436Corn, Switchgrass And Miscanthus RhizosphereMTALIDLWLMPARLWLDLVTVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070713_10137106523300005436Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPPKLAPVTSVDFVPLAKARYIRRRRKVLRSKR
Ga0070710_1004246743300005437Corn, Switchgrass And Miscanthus RhizosphereMTALIDLWLMPARLWLDLVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070710_1005812113300005437Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVTVTPLKLAPVTTVDFVPLAKARHIRRRRKVLRSKRGD*
Ga0066687_1005811343300005454SoilMPARLWLDLVAPLRPAPVTADFLPLAKARYIRRRRKVLRSKRGD*LDL
Ga0066687_1014876523300005454SoilMPALIDLWLMPARLWLDLVVPLRLAPVTTDLAPLAKARYIRRRRKVLRSRRGD*
Ga0066687_1021774713300005454SoilMPALIDLWLMPARFWLDLVAPLKLAPVATNVVSFAKARYIRRRRKVLRSKRGD*
Ga0070698_10095743913300005471Corn, Switchgrass And Miscanthus RhizosphereMPGLIDLWLMPARLWLDLVAPLKLARVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070672_10177042433300005543Miscanthus RhizosphereEPMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070695_10184063013300005545Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARSIRRRHKVLRSKRGD*
Ga0066661_1019365313300005554SoilMPALIDMWLMPARLWLELIAPLKLAPVTTNVVPFAKARYIRRRRKVLRSKRGD*
Ga0066661_1038576423300005554SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTDFVPLAKARYIRRRRKVLRSKRGD*
Ga0066699_1066804013300005561SoilIDLWLMPARLWLDLVVPLRLAPVTTDLAPLAKARYIRRRRKVLRSRRGD*
Ga0066702_1038629913300005575SoilMPALIDLWLMPARLWLDLVAPLKLAPVGTNVVSFAKARYIRRRHKVLRSKRGD*
Ga0066654_1040102713300005587SoilEEPTMPALIDLWLMPARLWLDLVAPLRLAPVTADLLPLAKARHIRRRRKVLRSKRGD*
Ga0066903_10145067343300005764Tropical Forest SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0066656_1016394343300006034SoilLVDLWLMPARLWLDFVAPLKHAPVTADLLPLAKARHIRRRRKVLRSKRGD*
Ga0070715_10003754103300006163Corn, Switchgrass And Miscanthus RhizosphereMSALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRG
Ga0070715_1024334123300006163Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPTRLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKV
Ga0070715_1086566113300006163Corn, Switchgrass And Miscanthus RhizosphereMPAMIDFWLMPARFWLDLVAPLKLAPMTTNVVPFAKARYIRRRRKVLRSKRGD
Ga0070716_10091864723300006173Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARHIRRRRKVLRSKRGD*
Ga0070716_10141065613300006173Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPTRLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRS
Ga0070712_10117053923300006175Corn, Switchgrass And Miscanthus RhizosphereMTALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0070712_10160235513300006175Corn, Switchgrass And Miscanthus RhizosphereALIDLWLMPARLWLDLVTVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0066660_1047154623300006800SoilMPALIDLWLMPARLWLDVVAPLRLAPVATDLVPLAKARYIRRRHKVLRSKRGD*
Ga0066660_1128477313300006800SoilMPALIDFWLMPARFWLDLVAPLKLAPVATNVVSFAKARYIRRRHKVLRSKRGD*
Ga0066660_1142419713300006800SoilMPALIDMWLMPARFWLELVAPLKLAPVTTNVVPFAKARYIRRRRKVLRSKRGD*
Ga0075435_10006824213300007076Populus RhizosphereMPALIDLWLMPARLWLDLVAPLKRATLTTDVVPLAKARYIRRKRKV*
Ga0105251_1026682713300009011Switchgrass RhizosphereMPALIDLWLMPARLWLDLIAPLKFARVTTVDFVPLAKARSIRRRHKVQAWVPRFAS
Ga0105243_1277372613300009148Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPPKLAPVTNVDFVPLAKARYIRRRRKVLR
Ga0134065_1026891713300010326Grasslands SoilMPALIDLWLMPARLWLDLVAPLRPAPVTADFLPLAKARYIRRRRKVLRSK
Ga0134121_1233406413300010401Terrestrial SoilMPALIDLWLMPARLWLDLVAPLKFARVTTVDFVPLAKARSIRRRHKVLRSKRGD*
Ga0105246_1097899213300011119Miscanthus RhizosphereMPALIDLWLMPARLWLNLIGPLKFARVTPVDFVPLAKARSIRRRHKVLRS
Ga0105246_1128900223300011119Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRR
Ga0137364_1004297023300012198Vadose Zone SoilMPALIDLWLMPARLWLDLVAPLKLAPVSTELVPFAKARYIRRRRKVLRAKRGD*
Ga0137382_1019819823300012200Vadose Zone SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTELVPFAKARYIRRRRKVL
Ga0137363_1040702523300012202Vadose Zone SoilMPALIDLWLMPTRLWLDLVAPLKLAPVTTNVVPFAKARYIRRRRKVLRSKRGD*
Ga0137362_1081438723300012205Vadose Zone SoilMPALMDLWLMPARLWLDLVAPLKLAPVTTNVVPFAKARYIRRRRKVLRSQRGD*
Ga0137376_1007325843300012208Vadose Zone SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTELVPFAKARYIRRRRKVLRAKRGD*
Ga0137377_1152828313300012211Vadose Zone SoilMPALIDMWLMPARLWLDLVAPLKLAPVTTNVVPFAKARYIRRRRKVLRSKRGD*
Ga0137384_1076776533300012357Vadose Zone SoilMPALIDLWLMPARLWLDLVAPLKLAPVITNVVPFAKARHIRRRHKVLRSKRGD*
Ga0137360_1039270633300012361Vadose Zone SoilMPALIDLWLTPARLWLDLVAPLKLAPVTTNVVPFAKARYIRRRLKVLRSKRGD*
Ga0164299_1058458013300012958SoilMSALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0164301_1150576113300012960SoilALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0134110_1023266623300012975Grasslands SoilMPALIDLWLMPARLWLDVVAPLKLAPVATDLVPLAKARYIRRRRKVLRSKRGD*
Ga0164304_1080315313300012986SoilMTALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0164305_1061065713300012989SoilLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0157374_1212585613300013296Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPLKLAPVNTVDFFPLAKARSIRRRHKVLRSKRGD*
Ga0157375_1220231813300013308Miscanthus RhizosphereMPALIDLWLMPARLWLDLIAPLKFARVTTVDFVPLAKARSIRRRHKVLRSKRGD*
Ga0157376_1311624413300014969Miscanthus RhizosphereTSTPKNEEPMPALIDLWLMPARLWLDLVAPPKLAPVTSVDFVPLAKARYIRRRRKVLRSKRGD*
Ga0132256_10348357813300015372Arabidopsis RhizosphereMPALIDLWLMPARLWLDLVAPLKLAPFATDVVPLAKARYVRRKRKVLRSKRGD*
Ga0182035_1003436663300016341SoilMPALIELWLMPARLWLDLVALLKLAPVTTVDFVPLAKARYIRRRRKVLRSTRGD
Ga0066667_1019483723300018433Grasslands SoilMPALIDLWLMPARLWFDLVAPHKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD
Ga0066662_1202446323300018468Grasslands SoilLWLMPARLWLDLVAPLKLAPVTADLLPLGKARHIRRRRKVLRAKRGD
Ga0066669_1007367813300018482Grasslands SoilMPALIDMWLMSARLWLDLIAPLKLAPVTTNVVPFANARHIRRRCKMLRSKRGA
Ga0066669_1024777923300018482Grasslands SoilMPALIDLWLMPARLWLDVVAPLKLAPVATDLVPLAKARYIRRRHKVLRSKRGD
Ga0066669_1096459623300018482Grasslands SoilMPALIDLWLMPARLWLDLVAPLKVAPVTTFDFVPLAKVRYIRRR
Ga0210405_1000031863300021171SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0210393_1034144923300021401SoilMPALIDLWLMPARLWLDLVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRTKRGD
Ga0210394_1063642313300021420SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLR
Ga0210391_1032741543300021433SoilSATSTPKTEEPMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0210402_1005951613300021478SoilMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPRAKARYIRRRRKVLRSKRGD
Ga0213853_1090232613300021861WatershedsLESQSEEPMPALIDLWLMPARVWLDLVAPLKLAPVTTDFVPLAKARYIRRRRKVLRSKRG
Ga0242659_104279823300022522SoilMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRTKRGD
Ga0242668_106053323300022529SoilMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGH
Ga0222756_104891213300022709SoilMPALIDLWLMPARLWLDLVTPLKLAPVTTVDFVPLAKARYIRRRRRC
Ga0207692_1102946713300025898Corn, Switchgrass And Miscanthus RhizosphereMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRR
Ga0207684_1032983623300025910Corn, Switchgrass And Miscanthus RhizosphereMPGLIDLWLMPARLWLDLVTPLKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD
Ga0207663_1163036123300025916Corn, Switchgrass And Miscanthus RhizosphereEPMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0207664_1133106413300025929Agricultural SoilMSALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0207670_1019020233300025936Switchgrass RhizosphereSATSTPKNEEPMPALIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0209234_106827123300026295Grasslands SoilMPALIDFWLMPARLWLDLVAPFKLAPVTIDLVPLAKARYIRRRRKVLRSKRGD
Ga0209234_123001613300026295Grasslands SoilMPALIDLWLMPARLWLDLVVPLRLAPVTTDLAPLAKARYIRRRRKVLRSRRGD
Ga0209153_100036353300026312SoilMPALIDLWLMPTRLWLDLVAPPKLAPVTTDLVPLAKARYIRRRRKVLRSKRGD
Ga0209731_101846423300027326Forest SoilMPALIDLWLMPARLWLDLVAPLKLAPLATDVVPLAKARYIRRKRKVLRSKRGD
Ga0209523_100206453300027548Forest SoilMPALFDLWLMPARLWLDLLAPLKLAPLATDVVPLAKARYIRRKRKVLRSKRGD
Ga0170823_1446942123300031128Forest SoilDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0170824_12307189513300031231Forest SoilMPALIDLWLMPARLWLDLIAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0170818_11157438713300031474Forest SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRS
Ga0170818_11289913113300031474Forest SoilIDLWLMPARLWLDLVAPPKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0318541_1017064013300031545SoilMPALIDLWLMPARLWLDLVAPLKLAPVTTVDFAPLAKARYIRRRRKVLRSKRGD
Ga0307476_1083044313300031715Hardwood Forest SoilMPALIDLWLMPARLWLDLVTVTPLKLAPITTVDFVPLAKARYIRRRRKVLRSKR
Ga0307474_1009528223300031718Hardwood Forest SoilMTALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0307477_1033429013300031753Hardwood Forest SoilALIDLWLMPARLWLDLVAPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0307475_1076767523300031754Hardwood Forest SoilMTALIDLWLMPARLWLDLVTPLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0310916_1125132923300031942SoilMPALIDLWLMPARLWLDLVAPLKLAPLTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0318533_1012854543300032059SoilMPALIELWLMPARLWLDLVALLKLAPVTTVDFVPLAKARYIRRRRKVLRSKRGD
Ga0306920_10245400023300032261SoilMPALIDLWLMPARLWLDLVAPLKLAAVTTVDFVPLAKARYIRRRRKVLRSKRGD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.