Metagenome / Metatranscriptome Family F100243

Basic Information
Family ID	F100243
Family Type	Metagenome / Metatranscriptome
Number of Sequences	102
Average Sequence Length	37 residues
Representative Sequence	LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Number of Associated Samples	72
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	72.55 %
% of genes near scaffold ends (potentially truncated)	42.16 %
% of genes from short scaffolds (< 2000 bps)	95.10 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Most Common Taxonomy
Group	Eukaryota (67.647 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (68.627 % of family members)
Environment Ontology (ENVO)	Unclassified (85.294 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (74.510 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF03732	Retrotrans_gag	0.98
PF00665	rve	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.98
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.98
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.98
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	67.65 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	65.69 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	65.69 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	65.69 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	65.69 %
Unclassified	root	N/A	32.35 %

Name	Rank	Taxonomy	Distribution
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	63.73 %
Unclassified	root	N/A	32.35 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	1.96 %

Name	Rank	Taxonomy	Distribution
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	63.73 %
Unclassified	root	N/A	32.35 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	1.96 %

Name	Rank	Taxonomy	Distribution
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	59.80 %
Unclassified	root	N/A	32.35 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1.96 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	1.96 %

Name	Rank	Taxonomy	Distribution
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	59.80 %
Unclassified	root	N/A	32.35 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1.96 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005719\|Ga0068861_100456024	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1147	Open in IMG/M
3300009177\|Ga0105248_10610702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1230	Open in IMG/M
3300009972\|Ga0105137_102561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	765	Open in IMG/M
3300009973\|Ga0105136_103727	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	800	Open in IMG/M
3300009973\|Ga0105136_107855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	629	Open in IMG/M
3300009981\|Ga0105133_114328	Not Available	644	Open in IMG/M
3300009981\|Ga0105133_116472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	619	Open in IMG/M
3300009981\|Ga0105133_125034	Not Available	547	Open in IMG/M
3300009987\|Ga0105030_117956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	635	Open in IMG/M
3300009989\|Ga0105131_138216	Not Available	530	Open in IMG/M
3300009989\|Ga0105131_140828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	517	Open in IMG/M
3300009990\|Ga0105132_119530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	658	Open in IMG/M
3300010371\|Ga0134125_11887645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	649	Open in IMG/M
3300010396\|Ga0134126_12828610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	526	Open in IMG/M
3300010396\|Ga0134126_12951472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	514	Open in IMG/M
3300010399\|Ga0134127_13370216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	523	Open in IMG/M
3300010403\|Ga0134123_10651930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1021	Open in IMG/M
3300012949\|Ga0153798_10212798	Not Available	684	Open in IMG/M
3300013306\|Ga0163162_12660895	Not Available	576	Open in IMG/M
3300013306\|Ga0163162_13270931	Not Available	519	Open in IMG/M
3300014325\|Ga0163163_11823207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	669	Open in IMG/M
3300014326\|Ga0157380_10920019	Not Available	902	Open in IMG/M
3300015270\|Ga0182183_1086443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	519	Open in IMG/M
3300015280\|Ga0182100_1009067	Not Available	1059	Open in IMG/M
3300015280\|Ga0182100_1019932	Not Available	848	Open in IMG/M
3300015290\|Ga0182105_1008986	Not Available	1095	Open in IMG/M
3300015290\|Ga0182105_1068245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	594	Open in IMG/M
3300015293\|Ga0182103_1081123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	548	Open in IMG/M
3300015297\|Ga0182104_1053341	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	671	Open in IMG/M
3300015297\|Ga0182104_1088985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	563	Open in IMG/M
3300015301\|Ga0182184_1047144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	653	Open in IMG/M
3300015309\|Ga0182098_1038133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	760	Open in IMG/M
3300015309\|Ga0182098_1116485	Not Available	521	Open in IMG/M
3300015311\|Ga0182182_1078356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	592	Open in IMG/M
3300015312\|Ga0182168_1032765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	844	Open in IMG/M
3300015312\|Ga0182168_1058078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	696	Open in IMG/M
3300015313\|Ga0182164_1119051	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532	Open in IMG/M
3300015315\|Ga0182120_1009102	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1247	Open in IMG/M
3300015315\|Ga0182120_1082472	Not Available	617	Open in IMG/M
3300015316\|Ga0182121_1123335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	540	Open in IMG/M
3300015318\|Ga0182181_1080522	Not Available	572	Open in IMG/M
3300015319\|Ga0182130_1092841	Not Available	583	Open in IMG/M
3300015327\|Ga0182114_1094009	Not Available	630	Open in IMG/M
3300015328\|Ga0182153_1113832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	566	Open in IMG/M
3300015330\|Ga0182152_1063688	Not Available	710	Open in IMG/M
3300015331\|Ga0182131_1075423	Not Available	670	Open in IMG/M
3300015331\|Ga0182131_1145480	Not Available	517	Open in IMG/M
3300015332\|Ga0182117_1125668	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	573	Open in IMG/M
3300015332\|Ga0182117_1141862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	544	Open in IMG/M
3300015336\|Ga0182150_1023145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1021	Open in IMG/M
3300015336\|Ga0182150_1162332	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	508	Open in IMG/M
3300015338\|Ga0182137_1154816	Not Available	536	Open in IMG/M
3300015338\|Ga0182137_1172899	Not Available	510	Open in IMG/M
3300015340\|Ga0182133_1151281	Not Available	559	Open in IMG/M
3300015340\|Ga0182133_1168736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532	Open in IMG/M
3300015340\|Ga0182133_1175397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	523	Open in IMG/M
3300015348\|Ga0182115_1001542	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3307	Open in IMG/M
3300015349\|Ga0182185_1151807	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	690	Open in IMG/M
3300015350\|Ga0182163_1086808	Not Available	936	Open in IMG/M
3300015350\|Ga0182163_1143340	Not Available	741	Open in IMG/M
3300015350\|Ga0182163_1233786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	576	Open in IMG/M
3300015350\|Ga0182163_1280054	Not Available	522	Open in IMG/M
3300015350\|Ga0182163_1288252	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	514	Open in IMG/M
3300015352\|Ga0182169_1211780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	633	Open in IMG/M
3300015353\|Ga0182179_1180765	Not Available	666	Open in IMG/M
3300015353\|Ga0182179_1239643	Not Available	583	Open in IMG/M
3300015353\|Ga0182179_1288304	Not Available	533	Open in IMG/M
3300015354\|Ga0182167_1285594	Not Available	588	Open in IMG/M
3300017408\|Ga0182197_1078329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	647	Open in IMG/M
3300017412\|Ga0182199_1034777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	965	Open in IMG/M
3300017412\|Ga0182199_1091591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	687	Open in IMG/M
3300017412\|Ga0182199_1118379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	624	Open in IMG/M
3300017414\|Ga0182195_1089131	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	722	Open in IMG/M
3300017421\|Ga0182213_1073646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	939	Open in IMG/M
3300017421\|Ga0182213_1143434	Not Available	671	Open in IMG/M
3300017422\|Ga0182201_1127726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	525	Open in IMG/M
3300017445\|Ga0182198_1189590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	517	Open in IMG/M
3300017447\|Ga0182215_1080805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	712	Open in IMG/M
3300017447\|Ga0182215_1107370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	625	Open in IMG/M
3300017693\|Ga0182216_1105485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	679	Open in IMG/M
3300017792\|Ga0163161_11213244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	653	Open in IMG/M
3300020031\|Ga0182119_101146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	861	Open in IMG/M
3300022465\|Ga0213505_104054	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1204	Open in IMG/M
3300025918\|Ga0207662_11230438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	532	Open in IMG/M
3300025931\|Ga0207644_11551883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	556	Open in IMG/M
3300025972\|Ga0207668_10962623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	762	Open in IMG/M
3300028050\|Ga0268328_1060342	Not Available	537	Open in IMG/M
3300028058\|Ga0268332_1078983	Not Available	503	Open in IMG/M
3300028253\|Ga0268316_1015341	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	585	Open in IMG/M
3300028253\|Ga0268316_1016050	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	577	Open in IMG/M
3300028256\|Ga0268304_1015189	Not Available	510	Open in IMG/M
3300028262\|Ga0268310_1020900	Not Available	682	Open in IMG/M
3300032464\|Ga0214492_1000483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3736	Open in IMG/M
3300032464\|Ga0214492_1021876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1191	Open in IMG/M
3300032591\|Ga0214484_1005259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2040	Open in IMG/M
3300032697\|Ga0214499_1218494	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	589	Open in IMG/M
3300032699\|Ga0214494_1000856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3186	Open in IMG/M
3300032759\|Ga0314720_1011178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1080	Open in IMG/M
3300032812\|Ga0314745_1001777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2975	Open in IMG/M
3300032822\|Ga0314740_1004177	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1754	Open in IMG/M
3300032827\|Ga0314730_104583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1392	Open in IMG/M
3300032918\|Ga0314726_115862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	852	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.14%
Environmental	Environmental	5.88%
Engineered	Engineered	0.98%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.14%
Terrestrial	Environmental → Terrestrial	5.88%
Bioreactor	Engineered → Bioreactor	0.98%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	74.51%
Unclassified	Host-Associated → Plants → Unclassified	8.82%
Soil	Environmental → Terrestrial → Soil	5.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.92%
Roots	Host-Associated → Plants → Roots	0.98%
Unclassified	Engineered → Bioreactor → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	74.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	8.82%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.90%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.96%
Loam	Environmental → Terrestrial → Soil → Loam	0.98%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	74.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	8.82%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.90%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.98%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.98%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	68.63%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	8.82%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.88%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.90%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.96%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.98%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020031	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032759	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032822	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032827	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032918	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F100243

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068861_1004560241	3300005719	Switchgrass Rhizosphere	LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105248_106107021	3300009177	Switchgrass Rhizosphere	LKASREILVPRADMVSDSVLARKCVPPHGTAVVGGKW*
Ga0105137_1025611	3300009972	Switchgrass Associated	LKASREILVLRADVVSDSVLARKCVPPHGTVVVGGKW*
Ga0105136_1037271	3300009973	Switchgrass Associated	LKASREILVPRADVVSDSVLDRKCVPPHGTAVVGGKW*
Ga0105136_1078551	3300009973	Switchgrass Associated	LKVSREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105133_1143281	3300009981	Switchgrass Associated	LLKPSREILVSRADVVSDSVLPRKCVPPHGTPVVGGKW*
Ga0105133_1164721	3300009981	Switchgrass Associated	LKASIEILVPRADTVSDSVLARKCVPPHGTTVVGGRW*
Ga0105133_1250341	3300009981	Switchgrass Associated	ASREILVSRANVVSDSVLARKCVPPHGTVVVGGKW*
Ga0105030_1179561	3300009987	Switchgrass Rhizosphere	LKASREILVPRANVVSDSVLARKCVPPHGTTVVGGKW*
Ga0105131_1382161	3300009989	Switchgrass Associated	SREILVPRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0105131_1408281	3300009989	Switchgrass Associated	LKASREILVPRADVVPDSVLARKCVPPHGTTVVGGK
Ga0105132_1195301	3300009990	Switchgrass Associated	LKASREILVPRADVVSDLVLARKCVPPYGTAVVGGKW*
Ga0134125_118876451	3300010371	Terrestrial Soil	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGSGDSLVRPS*
Ga0134126_128286101	3300010396	Terrestrial Soil	LKASREILVPRADVVSDTVLARKCVPPHGTAVVGGKW*
Ga0134126_129514721	3300010396	Terrestrial Soil	LKASREIQVLRADVVSDSVLARKCVPPHDTAVVGGK
Ga0134127_133702161	3300010399	Terrestrial Soil	LKASREILVPRADVVSDLVLARKCVPPYGAVVVGGKW*
Ga0134123_106519301	3300010403	Terrestrial Soil	LKASREILVPRADVVSDSVLARKCVPPRGTAVVGGKW*
Ga0153798_102127982	3300012949	Switchgrass Degrading	GFLLKASKEILVPRANVVSDSVPARKCVPPHGTIVVGGKW*
Ga0163162_126608951	3300013306	Switchgrass Rhizosphere	LKASSEILVPRADMVSDSVLARKCVPPHGTAVVGGKW
Ga0163162_132709311	3300013306	Switchgrass Rhizosphere	LKASREILVPRADVVPDSVLARKYVPPHGTAMVGGKW*
Ga0163163_118232071	3300014325	Switchgrass Rhizosphere	LKVSREILVSRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0157380_109200192	3300014326	Switchgrass Rhizosphere	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGK
Ga0182183_10864431	3300015270	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKCVPPHGTAVVGGKW*
Ga0182100_10090671	3300015280	Switchgrass Phyllosphere	LKALRDILVPRADVVSDSMLARKCVPPYGTAVVGDKW*
Ga0182100_10199321	3300015280	Switchgrass Phyllosphere	LKASTEILVPRADVMSNSMLARKFVPHHGTTVVGGKW*
Ga0182105_10089861	3300015290	Switchgrass Phyllosphere	LKASREILVPRADMVSDSMLARKCVPPHGTAVVGDEW*
Ga0182105_10682451	3300015290	Switchgrass Phyllosphere	LKASREILVPRADVVSDLVLARKCVPPHDTAVVGGKW*
Ga0182103_10811231	3300015293	Switchgrass Phyllosphere	LKESREILALRADVVSDLVLAKKCLPPYGTAVVVDNW*
Ga0182104_10533411	3300015297	Switchgrass Phyllosphere	LKASREILVPRADVVSDLVLARKCVPPHGTAVVGGKW*
Ga0182104_10889851	3300015297	Switchgrass Phyllosphere	LKASREILVPRADMVSDSVLSGRCVPPHGTVVVGG
Ga0182184_10471441	3300015301	Switchgrass Phyllosphere	LKASIEILVPRADVVSDSVLARKCVPLYGTAVVGGKW*
Ga0182098_10381331	3300015309	Switchgrass Phyllosphere	LKASRGILVPRADVVSDSVLARKCVPPHGTAVVVGKW*
Ga0182098_11164851	3300015309	Switchgrass Phyllosphere	LKASREILVTRANVVSILVLARKCIPLHDITVVVGKW*
Ga0182182_10783561	3300015311	Switchgrass Phyllosphere	LKASIEILVPRADVASDSVLARKCVPLYGTAVVGGKW*
Ga0182168_10327651	3300015312	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKCVSSHSITVVVGKW*
Ga0182168_10580781	3300015312	Switchgrass Phyllosphere	LKVSREILVPREDVVSDLVLARKCVPPHGTPVVGGKW*
Ga0182164_11190511	3300015313	Switchgrass Phyllosphere	LKASKEILLPRADMVSDSVLARKCVPPHGTTVVGGKW
Ga0182120_10091022	3300015315	Switchgrass Phyllosphere	LKASREILVPIADVVSDSVLARKCVPPHGAAVVGGK
Ga0182120_10824722	3300015315	Switchgrass Phyllosphere	LLKASREILVLRADVMSDSVLARKCVPPHGTVVVGSMW*
Ga0182121_11233351	3300015316	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTTVVGGKW*
Ga0182181_10805221	3300015318	Switchgrass Phyllosphere	LKALREILVPRADAVSDSVLARKFVPSHGTAVVGGKR*
Ga0182130_10928411	3300015319	Switchgrass Phyllosphere	KASREILVSSADVVSDLVLARECVPPHGTVVVGGRW*
Ga0182114_10940091	3300015327	Switchgrass Phyllosphere	ASIEILVPRADIVSDSVLARKCVPPHGTTVVGGKW*
Ga0182153_11138321	3300015328	Switchgrass Phyllosphere	LKASRDILVPRAAVVPDSVLARKCVPPHGTAVVVGKW*
Ga0182152_10636881	3300015330	Switchgrass Phyllosphere	LKASREILVPRADVMSDSVLARKYVPPHGTAVVGSKW*
Ga0182131_10754231	3300015331	Switchgrass Phyllosphere	RPLREILIPRVDEVSDSVLSRKCVPPHGNAVVGVNW*
Ga0182131_11454801	3300015331	Switchgrass Phyllosphere	SREILVPRADVVSDSVLARKCVPPHGTAVVGDKW*
Ga0182117_11256681	3300015332	Switchgrass Phyllosphere	LKATREILVPRADMVSDSVIARKCVPPHGTAMVGGKW*
Ga0182117_11418621	3300015332	Switchgrass Phyllosphere	LKASREILVPRTDVVSDSVLARKCVPPHGTAVVGGKW*
Ga0182150_10231451	3300015336	Switchgrass Phyllosphere	LKASREILVPRVDVVSDSVLARKCVTPHGTTVVGGKW*
Ga0182150_11623321	3300015336	Switchgrass Phyllosphere	LKALREILVLRADVVSDLVLARKCVPPHGTAVVGGKW
Ga0182137_11548161	3300015338	Switchgrass Phyllosphere	VEGPSREILVPSANVVSDLVLARKCVPPHGTAVVVSKW*
Ga0182137_11728991	3300015338	Switchgrass Phyllosphere	ASREILVSRADVVSDSVLARKCVPPHGIIVVGGKW*
Ga0182133_11512811	3300015340	Switchgrass Phyllosphere	FLLKASREILVPRADVASNSVLARKCVPPHSTAVVGGKW*
Ga0182133_11687361	3300015340	Switchgrass Phyllosphere	LKASREILVPRADVVSESVLARKCVPPHGTVVVGGKW
Ga0182133_11753971	3300015340	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKSVPPHGTAVVGGKW*
Ga0182115_10015423	3300015348	Switchgrass Phyllosphere	LKASREILVSRTDVVSNSVLARKCVPPHSTAVGGGKW*
Ga0182185_11518071	3300015349	Switchgrass Phyllosphere	LKVSREILVPRADVVSDSMLAIKCVPTHDTTVVGGKW*
Ga0182163_10868081	3300015350	Switchgrass Phyllosphere	ASREILTPRLDVVSNLVLARKCVPPHVTVVVVGKW*
Ga0182163_11433401	3300015350	Switchgrass Phyllosphere	LKASREILVPRADVVFDSVLARKYVPPHGTAVVVGKW*
Ga0182163_12337861	3300015350	Switchgrass Phyllosphere	LKVSREILVSRADVVSDSVLARKCVPPHGIAAVGGKW*
Ga0182163_12800541	3300015350	Switchgrass Phyllosphere	FLLKASREILALRVDVVSDLVLAKKCLPPHGTAVVVDNW*
Ga0182163_12882521	3300015350	Switchgrass Phyllosphere	LKASREILVSRTDVVSDSVLARKSVPPHGTAVVGGKW*
Ga0182169_12117801	3300015352	Switchgrass Phyllosphere	LKASREILVPSADMVSDLVLDRKCVLPHGTAVVVGKC
Ga0182179_11807651	3300015353	Switchgrass Phyllosphere	LKASREILVSRADVVSDSVLARKCVPTHGTAVVGG*
Ga0182179_12396432	3300015353	Switchgrass Phyllosphere	LLKASREILVPRADVVSDSVLAKKCVTPHGTAVVVCKW*
Ga0182179_12883041	3300015353	Switchgrass Phyllosphere	SREILVPRADMVSDSFLARKCVPPHGTTVVGGKW*
Ga0182167_12855941	3300015354	Switchgrass Phyllosphere	LKATREILTLCAYMVSSLALSRKCVPPHGTVVVGN
Ga0182197_10783291	3300017408	Switchgrass Phyllosphere	LKASREILVSRADVVSDSVLARKCVPPHGIIVVGGK
Ga0182199_10347771	3300017412	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTVVVGGKW
Ga0182199_10915911	3300017412	Switchgrass Phyllosphere	LKASREILVLRANVVSDSVLARKCVPPHGTAVVGGKWR
Ga0182199_11183791	3300017412	Switchgrass Phyllosphere	LNASREILVPSVDVVSDLVLARKCVPPHGTTVVVGKW
Ga0182195_10891311	3300017414	Switchgrass Phyllosphere	KASREILVPRADVVSDSVLARKCVPPHSTAVVGGKW
Ga0182213_10736461	3300017421	Switchgrass Phyllosphere	LKASREILVPRVDMVSDSVLARKCVPPHGTAVVGGKW
Ga0182213_11434341	3300017421	Switchgrass Phyllosphere	GGFLLKASREILVSRADVVSDLVQARKCVPPHVTAVVGGKW
Ga0182201_11277261	3300017422	Switchgrass Phyllosphere	GGFLLKASREILIPRVDVVPDSVLARKCVPPHGTAVVGGKW
Ga0182198_11895901	3300017445	Switchgrass Phyllosphere	LKASREILVLRANVVSDSVLARKCVPPHGTVVVGGKW
Ga0182215_10808051	3300017447	Switchgrass Phyllosphere	LKGSIEILVSRADMVSDSILARKCVPPHGTAVVGG
Ga0182215_11073701	3300017447	Switchgrass Phyllosphere	LKASREILVLRADVVSDLVLARKCVPPHNTTVLGGKW
Ga0182216_11054851	3300017693	Switchgrass Phyllosphere	LKASREILVLRADVVSDSVLARKSVPPHGTAVVGGKW
Ga0163161_112132441	3300017792	Switchgrass Rhizosphere	LKASREILVSRADVVSDSVLARKCVSPHGNAVVGGKW
Ga0182119_1011461	3300020031	Switchgrass Phyllosphere	LKASREILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0213505_1040541	3300022465	Switchgrass Phyllosphere	LKASIEILVPRADTVSDSVLARKCVPPHGTAVVGGKW
Ga0207662_112304381	3300025918	Switchgrass Rhizosphere	LKASREILVPRIAVVSGSVLARKCVPPHGTTVVGGKW
Ga0207644_115518831	3300025931	Switchgrass Rhizosphere	LKASREILVPREDVVSDSVLARKCVPPHGTAVAGGK
Ga0207668_109626231	3300025972	Switchgrass Rhizosphere	LKASREILVPRADVVSDSVIARKYVPPHGTAVVGGKW
Ga0268328_10603421	3300028050	Phyllosphere	MKASREILVPRADVMSDSVLTRKCVPLHGTVVVGGKW
Ga0268332_10789831	3300028058	Phyllosphere	ASREILILRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0268316_10153411	3300028253	Phyllosphere	LKASREILVSRADVVFDSVLARKCVPPHGTAVEGGKW
Ga0268316_10160501	3300028253	Phyllosphere	LKASREILILRVDVVSDSVLARKCVPPHGTVVVGGKW
Ga0268304_10151891	3300028256	Phyllosphere	LKASREILVSRADMVSDSVLVRKCVPPHGTAVVGGSGDS
Ga0268310_10209001	3300028262	Phyllosphere	LKASREILVSRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0214492_10004831	3300032464	Switchgrass Phyllosphere	LKASIEILVPRADTVSDSVLARKCVPPHGTTVVGGKW
Ga0214492_10218761	3300032464	Switchgrass Phyllosphere	LKASKEILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0214484_10052591	3300032591	Switchgrass Phyllosphere	LKASKEILVPRADVVSDSVLARKCVPPHGTVVVGGKW
Ga0214499_12184941	3300032697	Switchgrass Phyllosphere	LKASREILVPRADVMSDSVLTRKCVPLHGTIVVGGKW
Ga0214494_10008565	3300032699	Switchgrass Phyllosphere	GRLRGFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314720_10111783	3300032759	Switchgrass Phyllosphere	SFGRLRGFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314745_10017774	3300032812	Switchgrass Phyllosphere	LKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGK
Ga0314740_10041771	3300032822	Switchgrass Phyllosphere	LKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314730_1045831	3300032827	Switchgrass Phyllosphere	LKASIEILVPRADVVSDSVLARKCVPPHGTAVVGGKW
Ga0314726_1158621	3300032918	Switchgrass Phyllosphere	GFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign