Basic Information | |
---|---|
Family ID | F100514 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 40 residues |
Representative Sequence | AMKVSLENEAALVLAEIDQVTESQVRRPRGPRPATAARGPQ |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 9.09 % |
% of genes near scaffold ends (potentially truncated) | 9.80 % |
% of genes from short scaffolds (< 2000 bps) | 9.80 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (89.216 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.647 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF13620 | CarboxypepD_reg | 23.53 |
PF00005 | ABC_tran | 8.82 |
PF03379 | CcmB | 1.96 |
PF03918 | CcmH | 1.96 |
PF02321 | OEP | 1.96 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 3.92 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 89.22 % |
All Organisms | root | All Organisms | 10.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005995|Ga0066790_10471914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300011120|Ga0150983_12617570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
3300011120|Ga0150983_14133180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300012211|Ga0137377_10791688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300012384|Ga0134036_1195199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300017961|Ga0187778_10010331 | All Organisms → cellular organisms → Bacteria | 5829 | Open in IMG/M |
3300017975|Ga0187782_10257305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
3300019890|Ga0193728_1175479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300028780|Ga0302225_10327497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300031028|Ga0302180_10246615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300031469|Ga0170819_11885850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG3_09903210 | 2189573005 | Grass Soil | VLENEAALALTEIEQVTESQVRRPRPARPATVERGAR |
JGI12695J13573_10100771 | 3300001180 | Forest Soil | AMKVSLENEAALVLAEIDQVTESQVRRPRGPRPATAARGPQ* |
JGI25614J43888_100513852 | 3300002906 | Grasslands Soil | YSEGDFNAMKTSLENEAALILAQIDQVTESQVRRARGPAATERGQR* |
JGI25614J43888_101739541 | 3300002906 | Grasslands Soil | YSEGDFNAMKTSLENEAALILAQIDQVTESQVRRARGPAAAERGQR* |
Ga0062385_100619662 | 3300004080 | Bog Forest Soil | DYESMKTVLENEAAMALTEIEQVTESQVRRPRPAHPAIVERGAR* |
Ga0062389_1003573512 | 3300004092 | Bog Forest Soil | AENDYEAMKTSLENEAAMVLAEIDQITESQVRRPRGIKPVVPAADRGPQ* |
Ga0062389_1009262022 | 3300004092 | Bog Forest Soil | AMKVSLENEAALILAEIDQVTEAQTRRPRGTRPAPAAGGHS* |
Ga0066683_105350201 | 3300005172 | Soil | EAMKNAMETEAAMVLAEIDQVTEAGVRRPRGPRAAAERGPR* |
Ga0066388_1032996102 | 3300005332 | Tropical Forest Soil | MKASLENEAALVLTEIEQVTESQIRRARGVRGATPERSAR* |
Ga0066388_1048177901 | 3300005332 | Tropical Forest Soil | QAMKVSLENEAAQVVAEIDQVTEAHVRRPRGARSSEAERSQT* |
Ga0070733_110254341 | 3300005541 | Surface Soil | AENDYEAMKTTLENDAALALAEIDQITESQVRRPRAVKPATSDRGAQ* |
Ga0070761_105467912 | 3300005591 | Soil | YEAMKTTLEHEAALVLAEIDQVTESEVRRPRGIKPAPSDRGAQ* |
Ga0070762_101592141 | 3300005602 | Soil | MKTGLENDAAMVLAQIYQVTESQVRRPRGPRAADAERGAR* |
Ga0070766_107951512 | 3300005921 | Soil | DYQAMKLSLENEAALVLTEIDQVTESEVRRPRGIKPTAPDRGAQ* |
Ga0066790_104719142 | 3300005995 | Soil | KISIENEAALILAEIDQVTEAQTRRPRGPRPTSAAGSNS* |
Ga0075029_1006139431 | 3300006052 | Watersheds | GLENEAALALAEIDQVTEAQVRRPRAGRSASVDRSGQ* |
Ga0073928_103525872 | 3300006893 | Iron-Sulfur Acid Spring | DFEAMKVSLENEAALVLAEIDQVTESQVRRPRGPRPAAAARGPQ* |
Ga0073928_108038961 | 3300006893 | Iron-Sulfur Acid Spring | EAMKAGLENDAAMVLAEIDQVTEAQVRRPRGVRPPDAERGAR* |
Ga0099829_101132651 | 3300009038 | Vadose Zone Soil | LENEAALVVAEIDQVTEANVRRPRGARTAEPERGRQ* |
Ga0099827_116401521 | 3300009090 | Vadose Zone Soil | NEAALVLAEIEQVTESQVRRPRGGRPASAADRSAQ* |
Ga0074046_100749493 | 3300010339 | Bog Forest Soil | EAMKTALENEAALVLAEIERVTESQVRRPRAASPVASDRSAR* |
Ga0126370_104184502 | 3300010358 | Tropical Forest Soil | TSLENEAALVVTEIERLTDSQVRRPRGPRSTELDGSPR* |
Ga0126376_114829452 | 3300010359 | Tropical Forest Soil | LMKNSLENEAALVLTEIEQATDFDVRRPRAVRPAAAERSAR* |
Ga0126372_117761021 | 3300010360 | Tropical Forest Soil | NELAAVLAEVDQVTDAQTKRPRGARPAEAERSAR* |
Ga0126378_114121552 | 3300010361 | Tropical Forest Soil | EAMKTALENEAALVLAEIDRVTESQVRRPRGARPADRSAP* |
Ga0126345_12639272 | 3300010858 | Boreal Forest Soil | LENEAALVLAEIDQITESQVRRPRGTKPATSERGAE* |
Ga0150983_101338991 | 3300011120 | Forest Soil | NDAAVVLAEIDQITESQVRRPRGTKPATSERGAQ* |
Ga0150983_109687793 | 3300011120 | Forest Soil | SLENEAALVLTEIDQVTESQVRRARGVRPVETERGPR* |
Ga0150983_126175703 | 3300011120 | Forest Soil | LEHEAALVLTEIDQVTESEVRRPRGIKPAPSDRGAQ* |
Ga0150983_141331801 | 3300011120 | Forest Soil | KNALENEAALMLAEIDRVTESQTRRPRGIRPASADREAQ* |
Ga0137389_116627821 | 3300012096 | Vadose Zone Soil | LENEAALVLAEIEQVTESQVRRPRSGRPASAADRSAQ* |
Ga0137365_111741581 | 3300012201 | Vadose Zone Soil | GDFEAMKTALENEAALVLAEIEQVTESQVRRPRGGRPASAADRSAQ* |
Ga0137362_110206292 | 3300012205 | Vadose Zone Soil | ENEAALVLAEIDQVTESQVRRARGVRPVETERGQR* |
Ga0137362_111773362 | 3300012205 | Vadose Zone Soil | TSLENEAALVLTEIEQVTESQVRRARGTRPVETERGQR* |
Ga0137377_107916881 | 3300012211 | Vadose Zone Soil | AMKNSLETEAAMALAEIDQVTDAGVKRPRGPRASAERGAQ* |
Ga0134036_11951992 | 3300012384 | Grasslands Soil | KTALENEAALVLSEIDQVTEAQVRRPRGVHPADRSAQ* |
Ga0137394_100768461 | 3300012922 | Vadose Zone Soil | TALENEAALVLAEIDQVTESQVKRPRGARPSTADRSTP* |
Ga0137416_103761932 | 3300012927 | Vadose Zone Soil | FEAMKTALENEAALVLAEIDQVTEANIRRPRGARAAEAERGRR* |
Ga0137407_106773431 | 3300012930 | Vadose Zone Soil | FEAMKTALENEAALVLTEIDQVTESQVKRSRGPRPVSTDRSVQG* |
Ga0182041_121308162 | 3300016294 | Soil | YELMKASLENEAALVLTEIEQVTESQIRRPRGVRGAIPERSAR |
Ga0182032_103894141 | 3300016357 | Soil | ENEAALVLTEIEQVTDFDIRRPRAVRPAAAERSGQ |
Ga0182037_106564701 | 3300016404 | Soil | YSEGDYELMKNSLEEEAAVVLTEIEQVTESEVRRPRPVRPPDRSTR |
Ga0182039_119842391 | 3300016422 | Soil | ELMKNSLEEEAAVVLTEIEQVTESEVRRPRPVRPPDRSTR |
Ga0182038_100898203 | 3300016445 | Soil | TALENEAALVLTQVDEVTEAQVRRPRGVRPAASERGAR |
Ga0134112_105070561 | 3300017656 | Grasslands Soil | TALENEAALVLAEIEQVTESQVRRPRGGRPASAADRSAQ |
Ga0187778_100103317 | 3300017961 | Tropical Peatland | KASLENEAAMVLTEIEQVTESQVRRPRPASPATNERSAR |
Ga0187777_106113012 | 3300017974 | Tropical Peatland | LEEEAALVLTEIEQVTESQIRRPRVVRSSTPERSAR |
Ga0187782_102573052 | 3300017975 | Tropical Peatland | MKLALEQEAALVLAEIDQVTEAQVRRPRGVHPADRSAQ |
Ga0187804_100360571 | 3300018006 | Freshwater Sediment | KNSLEDEAALVLTEIEQVTESQIRRPRAVRSSTPERSAR |
Ga0187804_102121821 | 3300018006 | Freshwater Sediment | MKNSLENEAALVLTEIDQVTESQVRRPRPAARPAGTERSAR |
Ga0187810_101687821 | 3300018012 | Freshwater Sediment | EGDYELMKTSLENEAALVLTQIDEVTEAQVRRPRAVRPASTERSAR |
Ga0187770_107629501 | 3300018090 | Tropical Peatland | SEGDYETMKSTLENEAALVLAEIEQVTESQIRRPRPARPAAADRSAR |
Ga0193728_11754792 | 3300019890 | Soil | AMETEAALVLAEIDQVTDAGVKRPRGPRTAPERGPR |
Ga0210407_105114651 | 3300020579 | Soil | DYEAMKTSIESEAAMILAEIDQVTESQVRRPRPARAADAERGAR |
Ga0210403_106739612 | 3300020580 | Soil | TMKSALEVDAAMVLAEIDQVTDSQVRRPRGTRPAQTERGSQ |
Ga0210395_110858071 | 3300020582 | Soil | ISLENEAAQVLAEIDQVTESQVRRPRGIKPVASDRGAQ |
Ga0210401_104422892 | 3300020583 | Soil | MKVALENEAAMVLAEIDQVTEANVRRPRGARPAEAERGRQ |
Ga0210401_105029042 | 3300020583 | Soil | MKTSLEDEAALILTEIDQVTESQVRRPRAIKRVASDRGAQ |
Ga0210404_101936962 | 3300021088 | Soil | NAMKTSLENEAALVLTEIDQVTESQVRRARGVRPVETERGQR |
Ga0210396_105343091 | 3300021180 | Soil | ENDAAMVLAEIDQVTESQVRRPRGSRAVDAERGAR |
Ga0210393_116347722 | 3300021401 | Soil | EGDYELMKTSLENEAAVVLTEIEQVTESHVRRPRPVRLSDRSVR |
Ga0210387_112498751 | 3300021405 | Soil | SLENEAALVLTEIDQVTESEVRRPRGIKPTAPDRGAQ |
Ga0210394_114280312 | 3300021420 | Soil | FEAMKISLENEAALVLAEIDQVTDSQVRRPRAIKPVASDRGAQ |
Ga0210402_111815461 | 3300021478 | Soil | LENDAAVVLAEIDQITESQVRRPRGTKPATSERGAQ |
Ga0210410_104420762 | 3300021479 | Soil | SESDYDAMKTSIENEAALVLAEIEKVTESQVRRPRAARPAETERGQ |
Ga0126371_113575683 | 3300021560 | Tropical Forest Soil | YELMKASLENEAALVLTEIEQVTESQIRRPRGVRGAAPERSAR |
Ga0126371_130362543 | 3300021560 | Tropical Forest Soil | SLENEAALVLTEIEQVTESQIRRPRGVRGATPERSAR |
Ga0242660_10815311 | 3300022531 | Soil | TALENEAAMVLAEIDQVTESQVRRPRGARPLKTESGQR |
Ga0242677_10482791 | 3300022713 | Soil | ENDYEAMKTSLENDAAVVLAEIDQITESQVRRPRGTKPAASERGAQ |
Ga0242673_11273161 | 3300022716 | Soil | AMKISLENDAALVLAEIDQITESQVRRPRGTKPATSERGAQ |
Ga0247669_10078413 | 3300024182 | Soil | NAMRSSLEDEAAVVLAQVEQVTESQVRRPRTSRAAEPEHGHR |
Ga0207802_10218052 | 3300026847 | Tropical Forest Soil | LENEAALVLTEIEQVTDFDIRRPRAVRPAAAERSGQ |
Ga0207804_1162861 | 3300026849 | Tropical Forest Soil | SEGDYELMKTGLENEAALVLTEIEQVTDFDIRRPRAVRPATAERSGQ |
Ga0207726_10426881 | 3300027045 | Tropical Forest Soil | YEGMKTSLENEAAVLLTEIEQVTESQVRRPRPTRPAGAEKGAR |
Ga0208098_10139122 | 3300027172 | Forest Soil | ENEAALVLAEIDQVTDSQVRRPRAIKPVASDRGAQ |
Ga0209076_10460132 | 3300027643 | Vadose Zone Soil | GDYNAMRTSLENEAALVLAQIEQVTESQVRRPRAPRPAEPERGQ |
Ga0209117_11650872 | 3300027645 | Forest Soil | AIGSEAAMILAEIDQVTESQVRRPRPARPADAERGAR |
Ga0209388_11731941 | 3300027655 | Vadose Zone Soil | TALENEAALVLAEIDQVTQSQVKRPRGARPASADRSTP |
Ga0208990_10667442 | 3300027663 | Forest Soil | FEAMKVSLETEAALLLAEIDQVTESQVRRPRGPRPATAARGPQ |
Ga0209446_11058381 | 3300027698 | Bog Forest Soil | ENEAAMALTEIEQVTESQVRRPRPAHPAIVERGAR |
Ga0209590_100332671 | 3300027882 | Vadose Zone Soil | YEAMKISLENEAALVVAEIDQVTEANVRRPRGARAAEAERGRQ |
Ga0265357_10181841 | 3300028023 | Rhizosphere | DFEAMKLSLENEAAQVLAEIDQVTESQVRRPRGIKPAASDRGAL |
Ga0137415_105414531 | 3300028536 | Vadose Zone Soil | EAMKVALENEAALVLAEIDQVTEANIRRPRGARAAEAERGRR |
Ga0302225_103274972 | 3300028780 | Palsa | KTAMETEAALALAEIDQVTESQARRPRGPRPATAGGGKS |
Ga0308309_119118182 | 3300028906 | Soil | DYEAMKTSLENDAALVLAEIDQITESQVRRPRGIKPAASERGAQ |
Ga0302180_102466152 | 3300031028 | Palsa | ADYEAMKTAMETEAALALAEIDQVTESQARRPRGPRPATAGGGKS |
Ga0170820_106122832 | 3300031446 | Forest Soil | AMKNAMETEAALVLAEIDQVTEAGVKRPRGPRTAADRGAR |
Ga0170819_118858502 | 3300031469 | Forest Soil | KTGLENDAAMVLAEIDRVTEAQVRRPRGARTADAERGA |
Ga0318534_105415412 | 3300031544 | Soil | ENEAALVLAEIEQTTESQIRRPRPSRPAPVERGAR |
Ga0307474_108281452 | 3300031718 | Hardwood Forest Soil | MKNSLESEAALVLTEIEQVTESQIRRPRPTSRPAAADRSAR |
Ga0307469_105903902 | 3300031720 | Hardwood Forest Soil | TALENEAAMVLAEIDQVTEAQVKRPRGTRPASADRSGQ |
Ga0307469_114887602 | 3300031720 | Hardwood Forest Soil | MKTSLENEAALVLAEIDQITESQVRRPRGVKPVAPERGAR |
Ga0306918_104701811 | 3300031744 | Soil | TMKNTLENEAALVLAEIEQTTESQIRRPRPSRPAPVERGAR |
Ga0307478_115993312 | 3300031823 | Hardwood Forest Soil | GDYNAMKVSLENEAALVLAQIEQATESQVRRARGARPIETERGGQ |
Ga0306919_107596112 | 3300031879 | Soil | MKTALENEAALVLTQVDEVTEAQVRRPRGVRPATSERGAR |
Ga0306921_119813972 | 3300031912 | Soil | SSMEMEAAVVLAEIDQITDSVTKRPRGPKPAASRGAS |
Ga0310910_113613542 | 3300031946 | Soil | KYSEGDYELMKNSLEEEAAVVLTEIEQVTESQIRRPRAVRSSTPERSTR |
Ga0306924_103529341 | 3300032076 | Soil | GDYELMKAGLENEAALVLTEIEQATDFDVRRPRTVRPQAAERSGQ |
Ga0307470_100864073 | 3300032174 | Hardwood Forest Soil | DAMRISLENEAALVLAEIEKVTESQVRRPRAPRPAETERGQ |
Ga0307470_113530781 | 3300032174 | Hardwood Forest Soil | TSLENEAALVLTEIDQVTESQVRRARGVRPVETERGQR |
Ga0371489_0387470_50_175 | 3300033755 | Peat Soil | MMKNSLEEEAAIVLTEIEQVTESQIRRPRVVRSSTPERSAR |
Ga0371488_0061444_1275_1397 | 3300033983 | Peat Soil | MKTSLENEAALVLTEIEQVTESQVRRPHAVRPAATERSAR |
⦗Top⦘ |