 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F100556 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLRRVASQVSLRSRERKLRLFLELLAPGPETTVVDVGVTDA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.73 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere (7.843 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01182 | Glucosamine_iso | 12.75 |
| PF01381 | HTH_3 | 9.80 |
| PF12840 | HTH_20 | 2.94 |
| PF12844 | HTH_19 | 1.96 |
| PF13432 | TPR_16 | 1.96 |
| PF13560 | HTH_31 | 1.96 |
| PF00730 | HhH-GPD | 0.98 |
| PF13847 | Methyltransf_31 | 0.98 |
| PF13176 | TPR_7 | 0.98 |
| PF13181 | TPR_8 | 0.98 |
| PF05175 | MTS | 0.98 |
| PF13476 | AAA_23 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 12.75 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.98 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.98 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.98 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.98 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.67 % |
| All Organisms | root | All Organisms | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0607.00001540 | 2166559005 | Simulated | MLRRVASRVSMRSRERKLDLFRTLLQPGPDSTVVDVGVTDAPFGAGSTDNFF |
| A10PFW1_123750483 | 3300001538 | Permafrost | MLRRVASRVSMRSRERKLQLFLEAFHPGPETTVVDVGVTDAPR* |
| C688J35102_1205180702 | 3300002568 | Soil | MLRRVASSVSMRSRRQKLDLFLRTMGPGPESTVVDVGVTDAPFGGGSTDNFFEALYP |
| Ga0055467_101337741 | 3300003996 | Natural And Restored Wetlands | MGTRVLRRVAARASLRSRERKLRLFLESFAPGPETSVVDLGVTDSGYGGTYGTDN |
| Ga0063454_1000259501 | 3300004081 | Soil | VLRRVASRVSMRSRERKLRLFLDLMAPGPRTSVVDVGVTDA |
| Ga0070658_101173694 | 3300005327 | Corn Rhizosphere | MPSQVASRISHQISLRSRERKLQLFRELLTPGPETTVVDVGVTDAPFGGGSADNFFEAL |
| Ga0070714_1006189282 | 3300005435 | Agricultural Soil | VLRRVASRVSMRSREHKLRLFLELLAPGPETTVVDVGVTDAPFG |
| Ga0070699_1017390742 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRVASQVSLRSRKRKLELFLQLFEPGPGSSVVDVGVTNATFGDGSNDNF |
| Ga0070741_108991531 | 3300005529 | Surface Soil | MLRRVASQVSLRSRERKLQLFLELLGAGPETTVVDVGVTDAPFGGG |
| Ga0070741_110859004 | 3300005529 | Surface Soil | MLRSAAGRVSLRSREHKLRLFLELFRPGPQTSVLDVG |
| Ga0070684_1001093861 | 3300005535 | Corn Rhizosphere | VLKPLAASVSLRSRERKLGLFLELYQPGPETTVVDVGVTDAPFGGGSSDNFF |
| Ga0070684_1015011221 | 3300005535 | Corn Rhizosphere | MVNRAAARVSLRSRERKLRLFLELFHPGPETTVVDVGVTDAPF |
| Ga0070731_110792851 | 3300005538 | Surface Soil | MWSRERKLSLFLELFKPGPATTVVDVGVTDAPFGAGSSDNFFEALYPWP |
| Ga0068853_1016156591 | 3300005539 | Corn Rhizosphere | MRSRERKLQLFLELLEPGPETTVVDVGVTDAPFGGGSTDN |
| Ga0070695_1008207381 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRVASSVSLWSRERKLRLFLETYAPGPETTVVDVGVTDAPFG |
| Ga0070717_106951981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRVASRVSMRSRRRKLDLLLELFQPGPETTVIDVGVTDAP |
| Ga0066696_110160751 | 3300006032 | Soil | VRRIASRVSLASRERKLRLFLELCRPGPETTVVDIGVTDAPF |
| Ga0066656_111330001 | 3300006034 | Soil | VLRQAASRVSLASRERKLRLFLELYRPGPATTVVDVGV |
| Ga0075425_1017833022 | 3300006854 | Populus Rhizosphere | VIARAAAAVSLRSRRRKMEQFLRLIQPTEETTVVDVGVADTPFG |
| Ga0066710_1000904937 | 3300009012 | Grasslands Soil | VLRQAASRVSLASRERKLRLFLELYRPGPATTVVDVGVTDAPFGNGS |
| Ga0105245_103230371 | 3300009098 | Miscanthus Rhizosphere | MLSRVASRVSLHSRQRKLRLFHELLRPGPETTVLDVGATDAA |
| Ga0105245_110362712 | 3300009098 | Miscanthus Rhizosphere | MLRRVASHVSLRSRRRKLELFLELLAPGAGSSVVD |
| Ga0105245_118883981 | 3300009098 | Miscanthus Rhizosphere | MLRRVASQVSLRSRERKLRLFLDLLAPGPETTVVDVGVT |
| Ga0066709_1005134301 | 3300009137 | Grasslands Soil | VLRQAVSRVSLASRERKLRLFLELYRPGPETTVVDV |
| Ga0066709_1028028451 | 3300009137 | Grasslands Soil | VLRQAASRVSLRSRERKLRLFLELYRPGPQTTVVDVGVTDAPYG |
| Ga0066709_1030614622 | 3300009137 | Grasslands Soil | MLGRVASRVSLRSRQRKLERFLELFQPRPTTAVVDVGV |
| Ga0105243_121625873 | 3300009148 | Miscanthus Rhizosphere | MLRRAAARASFRSRERKMRLFLELFAPGPETTVIDVGVTDAPFG |
| Ga0105237_120459021 | 3300009545 | Corn Rhizosphere | VRTAASRVSLRSRERKLGLFLELFGPGPETTVVDVGVTDAPFGGG |
| Ga0126381_1008107291 | 3300010376 | Tropical Forest Soil | MQGLASRISLRSREQKLRLFLELLEPGPDTTVVDV |
| Ga0126383_126725291 | 3300010398 | Tropical Forest Soil | MMQGLASRISLRSREQKLRLFLELLEPGPDTTVVDVGVTDAPF |
| Ga0137370_110011312 | 3300012285 | Vadose Zone Soil | MLRRVASQVSLRSRERKLELFLALFEPGPGSSVVDVGVTNATFGGGSS |
| Ga0150984_1138716331 | 3300012469 | Avena Fatua Rhizosphere | MLRRAAARVSLWSRERKLRLFLELYRPGPGTSVVDVGVTDAPFGGGSSDNFFE |
| Ga0137359_103619911 | 3300012923 | Vadose Zone Soil | MLRRVASRVSMRSRERKLQLFLVLLQPGPETTVVDVGVTDAAFGAGSTDNFFEALYPWP |
| Ga0137419_118869212 | 3300012925 | Vadose Zone Soil | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVT |
| Ga0137410_119403982 | 3300012944 | Vadose Zone Soil | MRSRERKLQLFLELMQPGPETTVVDVGVTDAPFGGGSTDNFFEAL |
| Ga0164301_118459012 | 3300012960 | Soil | MLRRIASRVSMRSRERKLQLFLELLRPGPETTVVDVGVTDAAF |
| Ga0134087_105049941 | 3300012977 | Grasslands Soil | MLRRAASQVSLRSRERKLQLFLELLQPGPGSTVVDV |
| Ga0164309_112131192 | 3300012984 | Soil | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTDAAFGAGSTD |
| Ga0164307_105296741 | 3300012987 | Soil | MLSRVASRVSMRSRERKLQLFLELFRPGPETSVLDVGVTDAPFGGGST |
| Ga0157373_115454841 | 3300013100 | Corn Rhizosphere | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTDAAFGAGSTDNF |
| Ga0157374_100514491 | 3300013296 | Miscanthus Rhizosphere | MLRRVASQVSLRSRERKLRLFLDLLAPGPETTVVDVGVTDAP |
| Ga0120172_10369681 | 3300013765 | Permafrost | MLRRVASQVSLRSRERKLRLFLELLAPGPETTVVDVGVTDA |
| Ga0134075_105471992 | 3300014154 | Grasslands Soil | VLRRIASRVSLRSRTRKLDLFLETFRPGPDSTVVDVGVTDAP |
| Ga0163163_119456441 | 3300014325 | Switchgrass Rhizosphere | MLRRVASQVSLRSRERKLGLFLDLLAPGPESTVVDVGVTDAPFG |
| Ga0182024_104361643 | 3300014501 | Permafrost | MAHALAAAVSLRSRERKLRMFLDLYEPGPETSVLDVGVT |
| Ga0137412_112802522 | 3300015242 | Vadose Zone Soil | MLRRVASRVSMRSRRRKLDLLLELLQPGPDTTVVDVGVTD |
| Ga0132258_109512234 | 3300015371 | Arabidopsis Rhizosphere | MLRRVASRVSLRSRERKLRLFHELMRPTEATTVVDVGVT |
| Ga0132257_1005253591 | 3300015373 | Arabidopsis Rhizosphere | MLRRVASRVSLRSRERKLRLFLELLRPTESSTVVD |
| Ga0132255_1037577322 | 3300015374 | Arabidopsis Rhizosphere | MLRRVASRVSLRSRERKLRLFLELLRPAESSTVVDVGV |
| Ga0182034_107386591 | 3300016371 | Soil | MLNRAAARVSLRSRERKLRLFLELFHPGPETTVVDVGVTDAPFGGEDGSSDN |
| Ga0182034_109296792 | 3300016371 | Soil | MVQRLASWTSLRSREQKLRLLFELLRPGPETTVVDVGVTNAGFGGGSTDNFFE |
| Ga0134069_12978051 | 3300017654 | Grasslands Soil | MLRRVASQVSLRSRQRKLELFLDLLHAGPDSTVVDVGVTNAPFGAGSPDNFFEA |
| Ga0134069_13361031 | 3300017654 | Grasslands Soil | MLRRVASRVSLRSRERKLELFLDLLRPGPESSVLDVGVTN |
| Ga0187778_112910881 | 3300017961 | Tropical Peatland | MLRSAAARVSLWSRERKLRLFLELFGPGPETSVLD |
| Ga0206356_107337941 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSQVASRVSHQISLRSRERKLQLFRELLTPGPETTVVDVGVTDAPFGGGS |
| Ga0206354_111621072 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRVASRVSLRSRERKLSLFRELLEPGPETTVVDIGVTDAPF |
| Ga0206353_114952651 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRVASQVSLRSRERKLRLFLDLLQPGPDSTVIDVGVTNAPFGA |
| Ga0193699_100270361 | 3300021363 | Soil | MLRRVASRVSMRSRERKLQLFLDLLQPGPETSVVDVGVTDAPFGAGSTDNFFEALYPW |
| Ga0213874_102686682 | 3300021377 | Plant Roots | VLRQAASRISLRSRERKLRLFLELLAPTPSSTVLDVGV |
| Ga0213878_103157363 | 3300021444 | Bulk Soil | VWQSAAARVSLWSRERKLRLFLELYRPGPETSVVDVGVTDAPFGGGSSDN |
| Ga0210409_108278451 | 3300021559 | Soil | MLHQAAARISLRSRERKLRLFHELFRPGPATTVVDVGVTDA |
| Ga0222622_114276671 | 3300022756 | Groundwater Sediment | VIARAAAAASLRNRRRKLKLFLDFIDPTEETTVVDVGVADAPFGAGEGQA |
| Ga0208717_11397912 | 3300025574 | Arctic Peat Soil | MPSRVASRVSHQISLRSRQRKLQLFRELLAPGPQTTVVDVGVTDASSLWATDAFSM |
| Ga0207705_107271421 | 3300025909 | Corn Rhizosphere | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTDAPFGAGSTDN |
| Ga0207707_103907153 | 3300025912 | Corn Rhizosphere | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTDA |
| Ga0207707_104853201 | 3300025912 | Corn Rhizosphere | MLRRVASQVSLRSRERKLRLFLDLLAPGPETTVIDVGV |
| Ga0207695_103918623 | 3300025913 | Corn Rhizosphere | MPSQVASRVSHQISLRSRERKLQLFRELLTPGPETTV |
| Ga0207660_103281901 | 3300025917 | Corn Rhizosphere | MPNRVASRISHQISLRSRERKLQLFRELLDPGPETTVVDVGVTDAPFGGGSADNF |
| Ga0207657_112218831 | 3300025919 | Corn Rhizosphere | MLRRVASQVSLRSRERKLQLFLDLLQPGPDSTVVDVGV |
| Ga0207649_112829452 | 3300025920 | Corn Rhizosphere | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGV |
| Ga0207652_110480721 | 3300025921 | Corn Rhizosphere | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTDAPFGAGSTDNFFEALYP |
| Ga0207700_120319721 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRRVASRVSLRSRERKLRLFLDLMAPGPETTVVDVGVTD |
| Ga0207644_103089101 | 3300025931 | Switchgrass Rhizosphere | VLRRVASRVSMRSRERKLQLFLELFHPGPETTVLDVGVTNAPF |
| Ga0207644_110057331 | 3300025931 | Switchgrass Rhizosphere | VIRRAASGFSRRSRERKLRLFLELLAPGPETSVVDVGVTDSGVAGAYGTD |
| Ga0207686_113629641 | 3300025934 | Miscanthus Rhizosphere | MLHRVASRVSLRSRERKLQLFHELLRPGPETTVVDVGVTDAPF |
| Ga0207661_104301503 | 3300025944 | Corn Rhizosphere | MPNRVASRISHQISLRSRERKLQLFRELLDPGPETTVVDVGVTDAPF |
| Ga0207661_115567232 | 3300025944 | Corn Rhizosphere | MPSQVASRVSHQISLRSRERKLQLFRELLTPGPETTVVDVGVTD |
| Ga0207667_108443151 | 3300025949 | Corn Rhizosphere | MLRRFASQVSLRSRERKLRLFLDLLAPGPETTVVDVG |
| Ga0207667_115770672 | 3300025949 | Corn Rhizosphere | MRSRERKLQLFLELLDPGPETTVVDVGVTDAPFGRGSTDNFFE |
| Ga0209266_12177622 | 3300026327 | Soil | LSRLWSRERKLRLFLELYRPGPGTSVVDVGVTDAPFGDGSSDNF |
| Ga0209579_102653222 | 3300027869 | Surface Soil | MLRRAAARVSLWSRERKLRLFLELFDPGPETSVLDVGVTDAPFG |
| Ga0137415_106157812 | 3300028536 | Vadose Zone Soil | MRSRERKLQLFLELIQPGPETTVVDVGVTDAPFGSGSTDNFFEALYP |
| Ga0247824_104696151 | 3300028809 | Soil | MLRRVASRVSLRSRERKLRLFLDLFQPGPETTVVDV |
| Ga0307310_106440391 | 3300028824 | Soil | MLRRVASRVSMRSRERKLQLFLDLLQPGPETTVVDVGVTD |
| Ga0307312_105543722 | 3300028828 | Soil | MLSRVASRVSLRSRERKLRLFHELLQPGPETTVVDVGVTDAP |
| Ga0318516_106823921 | 3300031543 | Soil | MLNRAAARVSLRSRERKLRLFLDLFAPGPETTVVDVGVTDAPFGGE |
| Ga0318496_101086781 | 3300031713 | Soil | MVQRLASWTSLRSREQKLRLLFELLRPGPETTVVDVGVTNAGFGGGSTDNFFEARYP |
| Ga0306917_115109501 | 3300031719 | Soil | MLNRAAARVSLRSRERKLRLFLDLFDPGPETTVVDVGVTDAPF |
| Ga0318552_102101652 | 3300031782 | Soil | MVQRLASWTSLRSREQKLRLLFELLRPGPETTVVDVGVTNAGFG |
| Ga0306921_106597751 | 3300031912 | Soil | MLRRVASRVSMRSRERKLDLFRTLLQPGPETTVVD |
| Ga0308175_1010074711 | 3300031938 | Soil | MLRRVASQVSLRSRERKLGLFLDLLAPGPETTVVD |
| Ga0308175_1010711362 | 3300031938 | Soil | VLRRAASRVSLRSRERKLELFLELMAPTADSTIVDVGVTDAPF |
| Ga0315278_113403441 | 3300031997 | Sediment | MRPLATRVSMWSRERKLRLFMELLRPGPDTTVVDDGVTDAPFGSGSSDNFFE |
| Ga0308173_111767011 | 3300032074 | Soil | MLHRVASRVSLRSRERKLRLFLDLMAAGPQSTVVDVGVTNAPFGGGSTDN |
| Ga0335079_111005392 | 3300032783 | Soil | MLHGVASRVSLRSRERKLELLLSLLAPGPESTVVDVG |
| Ga0335078_109259282 | 3300032805 | Soil | MVHRAAARISLRSRERKLRLFLELFRPGPETTVIDVGVTDAP |
| Ga0335070_104439161 | 3300032829 | Soil | MLHGVASRVSLRSRERKLELLLSLLAPGPESTVVDVGVTNAPFGGGST |
| Ga0335075_109091862 | 3300032896 | Soil | MCPRPGRYAQPVLRRGAARVSLRSRERKLRLFQEAFAPGPDTTVVDVGVTNAPFGDGSSDNFLE |
| Ga0335083_100451617 | 3300032954 | Soil | MVTRAAARISLRSRERKLALFLETFHPDPQTTVVDVGVTDAP |
| Ga0335076_101490211 | 3300032955 | Soil | MLRRVASRVSLRSRERKLRQFLDLLAPGPETTVIDVGVTDAPFGN |
| Ga0318519_108452492 | 3300033290 | Soil | MVQRLASWTSLRSREQKLRLLFELLRPGPETTVVDVGVTNAGFGGGS |
| Ga0370484_0176827_466_579 | 3300034125 | Untreated Peat Soil | MLRRAASAVSMRSRRRKLDLFVEALRPGPGTTVVDVGV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |