Basic Information | |
---|---|
Family ID | F100599 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | FPASHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKV |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.98 % |
% of genes near scaffold ends (potentially truncated) | 69.61 % |
% of genes from short scaffolds (< 2000 bps) | 90.20 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.471 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.647 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.118 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.922 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00596 | Aldolase_II | 22.55 |
PF09957 | VapB_antitoxin | 14.71 |
PF01850 | PIN | 8.82 |
PF02604 | PhdYeFM_antitox | 4.90 |
PF13417 | GST_N_3 | 4.90 |
PF00106 | adh_short | 2.94 |
PF05016 | ParE_toxin | 2.94 |
PF01546 | Peptidase_M20 | 2.94 |
PF04255 | DUF433 | 1.96 |
PF09084 | NMT1 | 1.96 |
PF02371 | Transposase_20 | 1.96 |
PF07687 | M20_dimer | 1.96 |
PF13561 | adh_short_C2 | 0.98 |
PF02423 | OCD_Mu_crystall | 0.98 |
PF07859 | Abhydrolase_3 | 0.98 |
PF06296 | RelE | 0.98 |
PF16277 | DUF4926 | 0.98 |
PF02661 | Fic | 0.98 |
PF04909 | Amidohydro_2 | 0.98 |
PF00296 | Bac_luciferase | 0.98 |
PF00753 | Lactamase_B | 0.98 |
PF07883 | Cupin_2 | 0.98 |
PF01797 | Y1_Tnp | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 4.90 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 4.90 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.96 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.96 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.96 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.96 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.98 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.98 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.98 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.98 |
COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.47 % |
Unclassified | root | N/A | 23.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100721920 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1241 | Open in IMG/M |
3300000789|JGI1027J11758_13039931 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 731 | Open in IMG/M |
3300000956|JGI10216J12902_111293234 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300004156|Ga0062589_100166782 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300004156|Ga0062589_101296007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 704 | Open in IMG/M |
3300004268|Ga0066398_10013338 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300004480|Ga0062592_100041092 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
3300004643|Ga0062591_100174881 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300004778|Ga0062383_10054043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1591 | Open in IMG/M |
3300005328|Ga0070676_10116755 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
3300005338|Ga0068868_100287692 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300005339|Ga0070660_100286787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1348 | Open in IMG/M |
3300005340|Ga0070689_101545733 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005354|Ga0070675_100096867 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
3300005364|Ga0070673_100292196 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300005367|Ga0070667_100321742 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300005546|Ga0070696_100204440 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300005577|Ga0068857_100435266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1224 | Open in IMG/M |
3300005614|Ga0068856_100414109 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300006845|Ga0075421_100883219 | Not Available | 1022 | Open in IMG/M |
3300006846|Ga0075430_100110359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2294 | Open in IMG/M |
3300006847|Ga0075431_100750111 | Not Available | 952 | Open in IMG/M |
3300006854|Ga0075425_100723240 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300006881|Ga0068865_100129962 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
3300006894|Ga0079215_10035295 | Not Available | 1827 | Open in IMG/M |
3300006903|Ga0075426_10593618 | Not Available | 827 | Open in IMG/M |
3300006904|Ga0075424_100181902 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
3300006904|Ga0075424_102012399 | Not Available | 609 | Open in IMG/M |
3300006914|Ga0075436_100244423 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300009053|Ga0105095_10698355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
3300009087|Ga0105107_10641361 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300009093|Ga0105240_11947754 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300009094|Ga0111539_11162133 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300009094|Ga0111539_11223390 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300009111|Ga0115026_11327709 | Not Available | 591 | Open in IMG/M |
3300009147|Ga0114129_11513669 | Not Available | 824 | Open in IMG/M |
3300009156|Ga0111538_10135792 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
3300009156|Ga0111538_13559471 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 540 | Open in IMG/M |
3300009156|Ga0111538_14045699 | Not Available | 506 | Open in IMG/M |
3300009162|Ga0075423_11346247 | Not Available | 764 | Open in IMG/M |
3300009162|Ga0075423_11586280 | Not Available | 703 | Open in IMG/M |
3300009166|Ga0105100_10495681 | Not Available | 744 | Open in IMG/M |
3300009167|Ga0113563_13463922 | Not Available | 534 | Open in IMG/M |
3300009176|Ga0105242_12130164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 605 | Open in IMG/M |
3300009553|Ga0105249_11255294 | Not Available | 812 | Open in IMG/M |
3300010043|Ga0126380_10646501 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300010362|Ga0126377_10502688 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300010366|Ga0126379_10185608 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300010371|Ga0134125_12000865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300010373|Ga0134128_11859085 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300010396|Ga0134126_11010498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 931 | Open in IMG/M |
3300010397|Ga0134124_10197853 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300010397|Ga0134124_10425110 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300010400|Ga0134122_10494455 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300010400|Ga0134122_11755739 | Not Available | 650 | Open in IMG/M |
3300010403|Ga0134123_11732339 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300011406|Ga0137454_1000865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2033 | Open in IMG/M |
3300011412|Ga0137424_1054072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
3300011415|Ga0137325_1085215 | Not Available | 705 | Open in IMG/M |
3300011435|Ga0137426_1007741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2433 | Open in IMG/M |
3300012168|Ga0137357_1028198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
3300012882|Ga0157304_1106793 | Not Available | 518 | Open in IMG/M |
3300012922|Ga0137394_11544124 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300012927|Ga0137416_11553115 | Not Available | 602 | Open in IMG/M |
3300013296|Ga0157374_10312585 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300013306|Ga0163162_10883743 | Not Available | 1008 | Open in IMG/M |
3300014497|Ga0182008_10316343 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300014745|Ga0157377_10869236 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300014864|Ga0180068_1027345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 887 | Open in IMG/M |
3300014872|Ga0180087_1085520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
3300014968|Ga0157379_11142124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 747 | Open in IMG/M |
3300015245|Ga0137409_10828952 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 760 | Open in IMG/M |
3300015374|Ga0132255_104250341 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300015374|Ga0132255_104733041 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300018476|Ga0190274_10320612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
3300019360|Ga0187894_10115432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1411 | Open in IMG/M |
3300019889|Ga0193743_1080672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1280 | Open in IMG/M |
3300020083|Ga0194111_10785178 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300025903|Ga0207680_10206059 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300025907|Ga0207645_10239371 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300025919|Ga0207657_10305828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1259 | Open in IMG/M |
3300025921|Ga0207652_10496827 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300025926|Ga0207659_10299792 | Not Available | 1319 | Open in IMG/M |
3300025930|Ga0207701_10140767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2 | 2142 | Open in IMG/M |
3300025933|Ga0207706_10110550 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
3300025960|Ga0207651_10405207 | Not Available | 1161 | Open in IMG/M |
3300025981|Ga0207640_10755943 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300025986|Ga0207658_10509010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1073 | Open in IMG/M |
3300026078|Ga0207702_10886238 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300026116|Ga0207674_10456791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
3300027636|Ga0214469_1086190 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300027843|Ga0209798_10350191 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 699 | Open in IMG/M |
3300027909|Ga0209382_11538906 | Not Available | 661 | Open in IMG/M |
3300027909|Ga0209382_11974608 | Not Available | 561 | Open in IMG/M |
3300028809|Ga0247824_10836660 | Not Available | 571 | Open in IMG/M |
3300031716|Ga0310813_10922691 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031740|Ga0307468_100485177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
3300032002|Ga0307416_100395542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1417 | Open in IMG/M |
3300032126|Ga0307415_102473011 | Not Available | 511 | Open in IMG/M |
3300033408|Ga0316605_10190186 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300033433|Ga0326726_10078095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2929 | Open in IMG/M |
3300033434|Ga0316613_10914519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.84% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.98% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1007219202 | 3300000364 | Soil | PASHGDIYCVRAMDVNTPVDNFDAVIASHGSSLLAKI* |
JGI1027J11758_130399311 | 3300000789 | Soil | HRALPASHGDIYXVRAMDVNTPVDNFDAVIASHGSSLLAKI* |
JGI10216J12902_1112932344 | 3300000956 | Soil | ASHGDLYRVRAMDVNTPVDNFDAVIANHGSGLLAKV* |
Ga0062589_1001667824 | 3300004156 | Soil | MAFARDLPFPASHGDIYRVRAMDVNTPADNFDAMIASHGNGLLAKA* |
Ga0062589_1012960071 | 3300004156 | Soil | LQQGIEPFPASHGDIYRVRAMDVNTQVDNFDAMIASHGSGLLAKV* |
Ga0066398_100133382 | 3300004268 | Tropical Forest Soil | DLQQGIEPFPASHGDLYRVRAMDVNTAVDDFDAMIASHGNGLIAKI* |
Ga0062592_1000410924 | 3300004480 | Soil | MAFARDLPFPASHGDIYRVRAMDVNTQVDNFDAMIASHGSGLLAKV* |
Ga0062591_1001748814 | 3300004643 | Soil | MAFARDLPFPASHGDIYRVRAMDVNTPADNFDAMIASHGNGLLAKV* |
Ga0062383_100540434 | 3300004778 | Wetland Sediment | LQQGIEPFPASHGDIYRVRAMDVNTTLDNYDAVIASHGSGLLAKV* |
Ga0070676_101167553 | 3300005328 | Miscanthus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFDAVIASHGSSLLAKI* |
Ga0068868_1002876922 | 3300005338 | Miscanthus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFGAMIASHGNGLLAKA* |
Ga0070660_1002867872 | 3300005339 | Corn Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0070689_1015457332 | 3300005340 | Switchgrass Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0070675_1000968671 | 3300005354 | Miscanthus Rhizosphere | PASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0070673_1002921963 | 3300005364 | Switchgrass Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFGAMIASHGNGLLAKA* |
Ga0070667_1003217421 | 3300005367 | Switchgrass Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIASHGSSLLAKI* |
Ga0070696_1002044404 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFARDVPFPASHGDIYRVRATDVNTPADNFDAVIASHGRGLLAKV* |
Ga0068857_1004352663 | 3300005577 | Corn Rhizosphere | FPASHDEIYRVRAMDLTTPVDNFEVMIVEQGSGLVAKV* |
Ga0068856_1004141092 | 3300005614 | Corn Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNMQVDSFDAVIASHGNGLLAKA* |
Ga0075421_1008832192 | 3300006845 | Populus Rhizosphere | HGDIYRVRAMDVNTPVDNFDAVIAGHGSGLLAKA* |
Ga0075430_1001103594 | 3300006846 | Populus Rhizosphere | ELQQGIEPFPASHGDVYRVRAMDVNTAVDNFDAVIASHGSGLLAKM* |
Ga0075431_1007501111 | 3300006847 | Populus Rhizosphere | ELQQGIEPFPASHGDVYRVRAMDVNTPVDNFDAVIASHGSGLLAKV* |
Ga0075425_1007232401 | 3300006854 | Populus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFDAVI |
Ga0068865_1001299623 | 3300006881 | Miscanthus Rhizosphere | IFGFQSYLLVMAFARDLPFPASHRDIYRVRAIDVNTPVDNFGAMIASHGNGLLAKA* |
Ga0079215_100352953 | 3300006894 | Agricultural Soil | FPASHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKV* |
Ga0075426_105936182 | 3300006903 | Populus Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDSFDAVIASHGSGLLAKI* |
Ga0075424_1001819024 | 3300006904 | Populus Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKI* |
Ga0075424_1020123991 | 3300006904 | Populus Rhizosphere | RDLQQGIEPFPASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKA* |
Ga0075436_1002444231 | 3300006914 | Populus Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPADNFDAMIASHGNGLLAKA* |
Ga0105095_106983551 | 3300009053 | Freshwater Sediment | GVTHYRSRFPAYHGEIYRVRAMDVNTPLDNFEAMIVEHGSGLVAKV* |
Ga0105107_106413612 | 3300009087 | Freshwater Sediment | EPFPTSHGDIYRVRAMDVNTALEDFDAVIASHGSGLVAKV* |
Ga0105240_119477542 | 3300009093 | Corn Rhizosphere | MAFARDVPFPASNGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0111539_111621333 | 3300009094 | Populus Rhizosphere | PASHGDIYRVRAMDVNTPVDSFDAVIASHGSGLLAKI* |
Ga0111539_112233902 | 3300009094 | Populus Rhizosphere | VKLQQGIEPFPASHGDIYRVRAMNVNTPVDNFDAVIASHGSSLLAKI* |
Ga0115026_113277091 | 3300009111 | Wetland | HGDIYRVRAMDVNTAVDNFDAVLASHGSGLLAKA* |
Ga0114129_115136692 | 3300009147 | Populus Rhizosphere | PASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKA* |
Ga0111538_101357921 | 3300009156 | Populus Rhizosphere | HGDIYRVRAMDVNTAVDNFDAMIAGHGSGLLPKI* |
Ga0111538_135594711 | 3300009156 | Populus Rhizosphere | HGDIYRVRAMDVNTPVDNFDAVIASHGSSLLAKI* |
Ga0111538_140456992 | 3300009156 | Populus Rhizosphere | PFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0075423_113462472 | 3300009162 | Populus Rhizosphere | FARDVPFPASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKA* |
Ga0075423_115862801 | 3300009162 | Populus Rhizosphere | QQGIEPFPASHGDIYRVRAIDVNTPLDNFDAMIASHGSGLLAKALGCSR* |
Ga0105100_104956811 | 3300009166 | Freshwater Sediment | QGIEPFPASHGNIYRVRAMDVNTALDDYDVVIASHGSGLRAEV* |
Ga0113563_134639222 | 3300009167 | Freshwater Wetlands | DLQQGIEPFPASHGDIYRVRAMDVNTTVDDFDAVIANHGSGLLAKA* |
Ga0105242_121301641 | 3300009176 | Miscanthus Rhizosphere | PASHGDIYRVRAMDVNTPVDNFNAVIASHGSSLLAKI* |
Ga0105249_112552941 | 3300009553 | Switchgrass Rhizosphere | HGDIYRVRAMDVNTPVDNFDAMIASHGSGLLAKA* |
Ga0126380_106465011 | 3300010043 | Tropical Forest Soil | DLQQGIEPFPASHGDLYRVRAMDVNTAVDDFDAMIASHGNGLRAEV* |
Ga0126377_105026881 | 3300010362 | Tropical Forest Soil | DLQQGIEPFPASHGDLYRVRAMDVNTAVDDFDAMIASHGKGLRAEV* |
Ga0126379_101856083 | 3300010366 | Tropical Forest Soil | PFQASHGDLYRVRAMDVNTAVDDFDAMIASHGNGLIAKI* |
Ga0134125_120008652 | 3300010371 | Terrestrial Soil | MAFARDLPFPPSHGDIYRVRAMDVNTPVDNFGAMIASHGNGLLAKA* |
Ga0134128_118590852 | 3300010373 | Terrestrial Soil | TEPFPASHGDIYRVRAMDVKTTVDNFDAMIASHGSGLVAKA* |
Ga0134126_110104982 | 3300010396 | Terrestrial Soil | MAFARDVPFSASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKI* |
Ga0134124_101978531 | 3300010397 | Terrestrial Soil | FPASHGDIYRVRAMDVNTSVDNFDAMIASHGNGLLAKA* |
Ga0134124_104251103 | 3300010397 | Terrestrial Soil | ASHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKA* |
Ga0134122_104944554 | 3300010400 | Terrestrial Soil | MAFARDVPFSASHGDIYRVRAMDVNTPVDNFDAMIA |
Ga0134122_117557392 | 3300010400 | Terrestrial Soil | EPFPASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKV* |
Ga0134123_117323392 | 3300010403 | Terrestrial Soil | SHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKV* |
Ga0137454_10008651 | 3300011406 | Soil | QGDAYHVRAMDVNTQLDEYDAVIAEHGSGLVAKM* |
Ga0137424_10540722 | 3300011412 | Soil | ARVRPESYPASHGDAYHVHAMDVNTQLDEYDAVIAEHGSGLVAKM* |
Ga0137325_10852151 | 3300011415 | Soil | VQQRIEPFPTSNGDIYRVRAMDVNTVLDDYDAVIANHGSGLLAKA* |
Ga0137426_10077413 | 3300011435 | Soil | PASHGDVYRVRAMDVNTAVDDFHAVIASHGSGLLAKI* |
Ga0137357_10281981 | 3300012168 | Soil | THYRSRFPASHGEIYRVRAMDINTPLDNFEAMIAEHGSGLVAKV* |
Ga0157304_11067931 | 3300012882 | Soil | ELQQGIEPFQASHGDIYRVRAMDVNTPVDNFDAMIASHGSGLLAKI* |
Ga0137394_115441242 | 3300012922 | Vadose Zone Soil | PFPASHGDVYRVRAMDVNTPVDNFDAMIASHGSGLLAKV* |
Ga0137416_115531151 | 3300012927 | Vadose Zone Soil | RELQQGIEPFPASHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKA* |
Ga0157374_103125852 | 3300013296 | Miscanthus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFGAMIASHGNGLLAKASLTDC* |
Ga0163162_108837432 | 3300013306 | Switchgrass Rhizosphere | DIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC* |
Ga0182008_103163432 | 3300014497 | Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTQVDSFDAVIASHGNGLLAKA* |
Ga0157377_108692361 | 3300014745 | Miscanthus Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKA |
Ga0180068_10273453 | 3300014864 | Soil | QQGIEPFPASHGDVYRVRAMDVNTAVDDFDAVIASHGSGLVAKV* |
Ga0180087_10855201 | 3300014872 | Soil | ELQQGIEPFPASHGEIYRVRAMDVNTQLDEYDAVIAEHGSGLVAKM* |
Ga0157379_111421243 | 3300014968 | Switchgrass Rhizosphere | PASHGDIYRVRAMDVNTQVDNFDAMIASHGSGVLAKV* |
Ga0137409_108289521 | 3300015245 | Vadose Zone Soil | SHGDVYRVRAMDVNTPVDNFDPMIASHGSGLLAEV* |
Ga0132255_1042503411 | 3300015374 | Arabidopsis Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKA* |
Ga0132255_1047330412 | 3300015374 | Arabidopsis Rhizosphere | ASHGDIYRVRAMDVNTQADNFDAMLASHGNNLLAKA* |
Ga0190274_103206123 | 3300018476 | Soil | VSHGEIYRVRAMYVTTAPDDFDAMIASPGSGLLAKV |
Ga0187894_101154321 | 3300019360 | Microbial Mat On Rocks | ASHGDLYRVRAMDVNTAVDDFDAMIASHGKGLRAEV |
Ga0193743_10806721 | 3300019889 | Soil | ELQQGIEPFTASHGDVYRVRAMDVNTPVDNFDAVITSHGSGLLAAV |
Ga0194111_107851782 | 3300020083 | Freshwater Lake | LQQGIEPFPASHGDIYGVRAMDVNTAVDDFEAMIAKHGNGLRAGG |
Ga0207680_102060594 | 3300025903 | Switchgrass Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFGAMIASHGNGLLAKA |
Ga0207645_102393711 | 3300025907 | Miscanthus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPADNFDAMIASHGNGLLAKA |
Ga0207657_103058282 | 3300025919 | Corn Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC |
Ga0207652_104968274 | 3300025921 | Corn Rhizosphere | QGIEPFPASHGDIYRVRAMDVNTQVDNFDAMIASHGSGLLAKV |
Ga0207659_102997922 | 3300025926 | Miscanthus Rhizosphere | MAFARDLPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC |
Ga0207701_101407671 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLL |
Ga0207706_101105501 | 3300025933 | Corn Rhizosphere | QRGIEPFPASHGDIYRVRAMDVNTPLDNFDAMIASHGSGLLAKM |
Ga0207651_104052074 | 3300025960 | Switchgrass Rhizosphere | FPASHGDIYRVRAMDVNTPVDNFDAVIGSHGNGLLAKASLTDC |
Ga0207640_107559433 | 3300025981 | Corn Rhizosphere | LLVMAFARDLPFPASHGDIYRVRAMDVNTPADNFDAMIASHGNGLLAKA |
Ga0207658_105090103 | 3300025986 | Switchgrass Rhizosphere | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAVIASHGSGLLAKI |
Ga0207702_108862381 | 3300026078 | Corn Rhizosphere | QQGIEPFPASHGDIYRVRAMDVNTQVDNFDAMIASHGSGLLAKV |
Ga0207674_104567911 | 3300026116 | Corn Rhizosphere | HTCTSGHHYRSRFPASHDEIYRVRAMDLTTPVDNFEVMIVEQGSGLVAKV |
Ga0214469_10861901 | 3300027636 | Soil | GIEPFPASHGDIYRVRAMDVNTPVDNFDAVIATHGSGLLAKA |
Ga0209798_103501911 | 3300027843 | Wetland Sediment | SHGDIYRVRAMDVNTAVDDFDAVIANHGSGLLAKV |
Ga0209382_115389062 | 3300027909 | Populus Rhizosphere | LQQGIEPFPASHGEVYRVRAMDVNTPVDNFDAVIASHGSGLLAKV |
Ga0209382_119746081 | 3300027909 | Populus Rhizosphere | SHGDIYRVRAMDVNTPVDNFDAVIAGHGSGLLAKA |
Ga0247824_108366601 | 3300028809 | Soil | ELQQGIEPFPASHGDIYRVRAMDVNTPVDNFDAMIAGHGSGLIAKA |
Ga0310813_109226913 | 3300031716 | Soil | MAFARDVPFPASHGDIYRVRAMDVNTPVDNFDAMIASHGNGLLAKV |
Ga0307468_1004851772 | 3300031740 | Hardwood Forest Soil | VYHGEIYRVRAMDVNTPLDNFEAVIVEHGSGLVAKV |
Ga0307416_1003955424 | 3300032002 | Rhizosphere | FPASHGDIYRVRAMDVNTPVDNFDAMIASHGSGLRAKA |
Ga0307415_1024730112 | 3300032126 | Rhizosphere | QGIEPFPASHGDIYRVRAMDVNTAVDNFDAMIASHGSGLLAKA |
Ga0316605_101901861 | 3300033408 | Soil | IEPYPASHGDIYRVRAMDVNTAVDNFDAVLASHGSGLLAKA |
Ga0326726_100780951 | 3300033433 | Peat Soil | DLQQGIEPFPASHGDIYRVRAMDVNTALDDYDAVIASHGSGLLAKV |
Ga0316613_109145192 | 3300033434 | Soil | SHGDVYRVRAMDVNTALDDFDAVIASHGSGLMAKG |
⦗Top⦘ |