NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100873

Metagenome / Metatranscriptome Family F100873

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100873
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 49 residues
Representative Sequence MKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMGLLKVGM
Number of Associated Samples 90
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.47 %
% of genes near scaffold ends (potentially truncated) 48.04 %
% of genes from short scaffolds (< 2000 bps) 72.55 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(39.216 % of family members)
Environment Ontology (ENVO) Unclassified
(52.941 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(65.686 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.26%    β-sheet: 0.00%    Coil/Unstructured: 39.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF00011HSP20 2.94
PF13414TPR_11 2.94
PF00857Isochorismatase 2.94
PF13287Fn3_assoc 1.96
PF13561adh_short_C2 1.96
PF07676PD40 1.96
PF01139RtcB 1.96
PF00795CN_hydrolase 0.98
PF16177ACAS_N 0.98
PF14437MafB19-deam 0.98
PF08544GHMP_kinases_C 0.98
PF14067LssY_C 0.98
PF08410DUF1737 0.98
PF13673Acetyltransf_10 0.98
PF13649Methyltransf_25 0.98
PF00069Pkinase 0.98
PF12838Fer4_7 0.98
PF13290CHB_HEX_C_1 0.98
PF05231MASE1 0.98
PF07690MFS_1 0.98
PF00884Sulfatase 0.98
PF13365Trypsin_2 0.98
PF03144GTP_EFTU_D2 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.92
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 2.94
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 2.94
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 2.94
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 1.96
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.98
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.98
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102HW6JZAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium519Open in IMG/M
2170459009|GA8DASG02HHU78All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium540Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100308507All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium740Open in IMG/M
3300000550|F24TB_10658845All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_55_10793Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1021933All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300000956|JGI10216J12902_107518230All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1353Open in IMG/M
3300002899|JGIcombinedJ43975_10019090All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300002899|JGIcombinedJ43975_10115492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300002914|JGI25617J43924_10176748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium714Open in IMG/M
3300002915|JGI25387J43893_1043818All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia618Open in IMG/M
3300004114|Ga0062593_101122886All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300004156|Ga0062589_100733181All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005166|Ga0066674_10005202All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium5066Open in IMG/M
3300005166|Ga0066674_10052894All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1835Open in IMG/M
3300005167|Ga0066672_10053069All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2333Open in IMG/M
3300005175|Ga0066673_10682673All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium592Open in IMG/M
3300005179|Ga0066684_10943596All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M
3300005184|Ga0066671_10116266All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1509Open in IMG/M
3300005187|Ga0066675_11212776All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium559Open in IMG/M
3300005293|Ga0065715_10847980All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia592Open in IMG/M
3300005332|Ga0066388_102634693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia916Open in IMG/M
3300005343|Ga0070687_101051080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300005447|Ga0066689_10032834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2661Open in IMG/M
3300005447|Ga0066689_10599968All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_55_10694Open in IMG/M
3300005467|Ga0070706_100085180All Organisms → cellular organisms → Bacteria2928Open in IMG/M
3300005540|Ga0066697_10669710All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium570Open in IMG/M
3300005545|Ga0070695_100276434All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1232Open in IMG/M
3300005553|Ga0066695_10160421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1402Open in IMG/M
3300005553|Ga0066695_10814909All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300005555|Ga0066692_10043524All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2460Open in IMG/M
3300005556|Ga0066707_10134463All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300005566|Ga0066693_10295659All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium646Open in IMG/M
3300005576|Ga0066708_10134624All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1503Open in IMG/M
3300005576|Ga0066708_10939040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
3300005586|Ga0066691_10439303All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium778Open in IMG/M
3300005598|Ga0066706_10676520All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300005598|Ga0066706_11220682All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium571Open in IMG/M
3300005610|Ga0070763_10928582All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium519Open in IMG/M
3300006032|Ga0066696_10791545All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium605Open in IMG/M
3300006032|Ga0066696_10857857All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium578Open in IMG/M
3300006791|Ga0066653_10057599All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300006796|Ga0066665_10866838All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300006852|Ga0075433_11074354All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium700Open in IMG/M
3300007255|Ga0099791_10272062All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium805Open in IMG/M
3300009162|Ga0075423_11907236All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium642Open in IMG/M
3300010320|Ga0134109_10303514All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium615Open in IMG/M
3300010323|Ga0134086_10008314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3147Open in IMG/M
3300012199|Ga0137383_10212142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1418Open in IMG/M
3300012199|Ga0137383_10222886All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300012201|Ga0137365_10130956All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300012202|Ga0137363_10432261All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300012205|Ga0137362_10868083All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium771Open in IMG/M
3300012209|Ga0137379_10978794All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium751Open in IMG/M
3300012211|Ga0137377_11106628All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium722Open in IMG/M
3300012285|Ga0137370_10004077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium6495Open in IMG/M
3300012354|Ga0137366_10990639All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium585Open in IMG/M
3300012356|Ga0137371_11309227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium536Open in IMG/M
3300012360|Ga0137375_11059869All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium633Open in IMG/M
3300012929|Ga0137404_10008202All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae7148Open in IMG/M
3300012929|Ga0137404_10010508All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus6397Open in IMG/M
3300012929|Ga0137404_10034892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3753Open in IMG/M
3300012930|Ga0137407_10010344All Organisms → cellular organisms → Bacteria6591Open in IMG/M
3300012975|Ga0134110_10076621All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1334Open in IMG/M
3300012976|Ga0134076_10210182All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium819Open in IMG/M
3300012977|Ga0134087_10433591All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium647Open in IMG/M
3300014157|Ga0134078_10165294All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium880Open in IMG/M
3300015359|Ga0134085_10007981All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3868Open in IMG/M
3300017657|Ga0134074_1076604All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1140Open in IMG/M
3300018468|Ga0066662_11791205All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium642Open in IMG/M
3300018482|Ga0066669_12001283All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium543Open in IMG/M
3300019867|Ga0193704_1080522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_55_10598Open in IMG/M
3300019869|Ga0193705_1001842All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus4724Open in IMG/M
3300019879|Ga0193723_1009399All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus3166Open in IMG/M
3300019886|Ga0193727_1004806All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5506Open in IMG/M
3300019887|Ga0193729_1036674All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2044Open in IMG/M
3300020006|Ga0193735_1029137All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300020034|Ga0193753_10357045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300020170|Ga0179594_10389309All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_55_10529Open in IMG/M
3300026277|Ga0209350_1004592All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4890Open in IMG/M
3300026300|Ga0209027_1187843All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia672Open in IMG/M
3300026306|Ga0209468_1000448All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia20058Open in IMG/M
3300026324|Ga0209470_1020378All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3596Open in IMG/M
3300026327|Ga0209266_1208773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium696Open in IMG/M
3300026327|Ga0209266_1278488All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300026329|Ga0209375_1016110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus4424Open in IMG/M
3300026330|Ga0209473_1005661All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium6554Open in IMG/M
3300026332|Ga0209803_1148314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_2_20CM_55_10910Open in IMG/M
3300026334|Ga0209377_1305612All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300026523|Ga0209808_1116368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1105Open in IMG/M
3300026528|Ga0209378_1016426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4255Open in IMG/M
3300026536|Ga0209058_1014043All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium5522Open in IMG/M
3300026538|Ga0209056_10014922All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia7738Open in IMG/M
3300026538|Ga0209056_10101607All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2343Open in IMG/M
3300026547|Ga0209156_10371039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium608Open in IMG/M
3300026552|Ga0209577_10705827All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium570Open in IMG/M
3300027682|Ga0209971_1045627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1057Open in IMG/M
3300028828|Ga0307312_10032907All Organisms → cellular organisms → Bacteria3031Open in IMG/M
3300028878|Ga0307278_10005254All Organisms → cellular organisms → Bacteria6212Open in IMG/M
3300030945|Ga0075373_11560654All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300031231|Ga0170824_116514722All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300031720|Ga0307469_12280882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300033412|Ga0310810_10046349All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5307Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil39.22%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_047468002170459002Grass SoilAKRTEMKYKIKSFIVGVKEARGIFCTTAYGRPARKAYNMGRKLSNGFLGLLKLRMG
F47_056539902170459009Grass SoilMKYKIKSFILGVKEARRILCTGVHGRPARKAYNMGR
INPhiseqgaiiFebDRAFT_10030850713300000364SoilMKDKIKSFILGVREARRLVCTTIHGQPARRAYETGRKLSNGFMDLLKFRMGWD*
F24TB_1065884523300000550SoilMKYKIKSFIVGVKEARRILCTTVYGQPARRAYDMGRKLS
KanNP_Total_noBrdU_T14TCDRAFT_102193333300000596SoilMKYKIQSFIVGVKEARGILCTTVYGRPARKAYDMGRKLSNGFLGL
JGI10216J12902_10751823023300000956SoilMKDKIKSFILGVREARRLVCTTVHGQPARRAYETGRKLSNGFMDLLKFRMG*
JGIcombinedJ43975_1001909013300002899SoilRMKYKIKSFIVGVKEARRTLCTTVYGQPAGRAYDMGRKLSNGFMGLLNVGTG*
JGIcombinedJ43975_1011549213300002899SoilMTYKIKSFIIGVQEGRRVVCTTVDGQPARKAYDIGRKLSNGFMDLLKAGMA*
JGI25617J43924_1017674823300002914Grasslands SoilMKYKIKSFMLGVKEARRVLCTTVHGRPAGRAYDAGRRLSNGFTGLFKVRMT*
JGI25387J43893_104381813300002915Grasslands SoilKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA*
Ga0062593_10112288623300004114SoilMKYKIKSFALGVKEARWILCTTVYGRPARMAYDIGRKLSNGFTGLLKVRMA*
Ga0062589_10073318113300004156SoilLRSAPHGAARHFDAKGDQRMKYKIKSFALGVKEARWILCNTVYGRPARMAYDIGRKLSNGFTGLLKVRMA*
Ga0066674_1000520223300005166SoilMKYKIISFIVGVKEARRVLCTTVYGRPAKRAYDMGRKLSNGFMGLLLKSGMV*
Ga0066674_1005289443300005166SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA*
Ga0066672_1005306943300005167SoilMKYKIRSFILGVKEARRILCTTVYGQPARTAYDMGRKLSNGFIGILKSEMV*
Ga0066673_1068267313300005175SoilMKYTIKSFIVGVKEARRILCTTVHGQPARTAYDMGRKLSNGFMGLLKVGMA*
Ga0066684_1094359623300005179SoilMKYTIKSFIVGVKEARRILCTTVQGRPARRAYDMGRKLSNGFVGLLKVGMG*
Ga0066671_1011626623300005184SoilMKYTIKSFIVGVKEARRILCTTVHGRPARTAYDMGRKLSNGFMGLLKVGMA*
Ga0066675_1121277623300005187SoilMKYTIKSFIVGVKEARRILCTTVQGRPARRAYDMGRKLSNGFVGLLKVGMA*
Ga0065715_1084798013300005293Miscanthus RhizosphereMKYKIKSFIVGVKEARWILCTTVYGQPARRAYDMGRKLSNGFTDLLKVVGMA*
Ga0066388_10263469333300005332Tropical Forest SoilMKYKNKSFIVGVKEARRATAVHRRPAGRAYDAGRKLSNGFTGLFKVRMT*
Ga0070687_10105108013300005343Switchgrass RhizosphereMKYKIKSFIVGVKEARWILCTTVYGQPARRAYDMGRKLSNGF
Ga0066689_1003283423300005447SoilMKYQIISFIVGVKEARRVLCTTVYGRPAKRAYDMGRKLSNGFMGLLLKSGMV*
Ga0066689_1059996813300005447SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFM
Ga0070706_10008518033300005467Corn, Switchgrass And Miscanthus RhizosphereMKYKNKSFILGVKEARRATTVHGRPAGRAYDAGRKLSNGFTGLFKVRMT*
Ga0066697_1066971023300005540SoilMKYKIKSFILGVKEARWILCTTIYGRSARRAYDMGRKLSNGFTGLLK
Ga0070695_10027643413300005545Corn, Switchgrass And Miscanthus RhizosphereGRMKYTIKSFILGAKEARSILCTTVYGRPARTAYEMGRKLSKGFTGHKL*
Ga0066695_1016042123300005553SoilMKYNIKSFVLGLREARRVWCTTVYGRPARNAYNMGRKLSTGFMDLLKLRIG*
Ga0066695_1081490913300005553SoilMKYKIKSFVLGLKEARRVWCTTVYGGPARNAYNMGRKLSNGFMDLLKLRIG*
Ga0066692_1004352413300005555SoilMKYTIKSFILGAKEARSILCTTVYGRPARRAYDMGRKLSKGVMGLSKGEWHN
Ga0066707_1013446333300005556SoilMEYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA*
Ga0066693_1029565923300005566SoilMKYTIKSFILGAKEARSILPFMVGPPERAYDMGRKLSKGVMGLSNARMA*
Ga0066708_1013462433300005576SoilMKYKIKSFIVGVKEARRTLCTTVYGQPARRAYDMGRKLSNRFMDLLKVVQMA*
Ga0066708_1093904023300005576SoilMKYKIKSFIIGVKEGRRVVCTTVYGRPARKAYDMGRKLSN
Ga0066691_1043930323300005586SoilMKYTIKSFILGAKEARSILCTTVYGRPARRAYDMGRKLSKGVMGLSKGEWHNKGCQTDY*
Ga0066706_1067652033300005598SoilMKYKIKSFIVGVKEARRILCTTVYGQPATRAYDMGRRLSNGFTDLLKVVGMA*
Ga0066706_1122068213300005598SoilQRMKYKIKSFVLGVKEARWMLCTTVYGGSARRAYDMGRKLSNGFTGLLKVRTA*
Ga0070763_1092858223300005610SoilMTYKIKSFIIGVKEGRRVVCATGYGQPARKAYDIGRKLSNGFMDLLKAGMA*
Ga0066696_1079154523300006032SoilMKYTIKSFIVGVKEARRILCTTVHGRPARTAYDMGRKLSNGFMGL
Ga0066696_1085785713300006032SoilMKYTIKSFIVGVKEARRILCTTVHGRPARTAYDMGRKLSNGFMGLLKVG
Ga0066653_1005759923300006791SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNRFMDLLKAGMA*
Ga0066665_1086683823300006796SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARSAYDIGRKLSNGLMDLLKLRMG*
Ga0075433_1107435413300006852Populus RhizosphereIVGVKEARGILCTTIYGRPARKAYDMGRKLSNGFLGLLKLRMG*
Ga0099791_1027206213300007255Vadose Zone SoilKIKSFMLGVKEARRVLCTTVRGRPAGRAYDAGRRLSNGFTGLFKVRMT*
Ga0075423_1190723613300009162Populus RhizospherePAKRTEMKYKIKSFIVGVKEARGILCTTIYGRPARKAYDMGRKLSNGFLGLLKLRMG*
Ga0134109_1030351423300010320Grasslands SoilMKYKIKSFIVGVKEARGILCTTAYGRPARKAYNMGRKLSNGFLGLLKLRMG*
Ga0134086_1000831473300010323Grasslands SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYDMGRKLSTGLMDLLKLRMG*
Ga0137383_1021214233300012199Vadose Zone SoilMKYKIKSFIIGVKEGRRVVCTTVYGRPARKAYDMGRKLYNGFMDLLKAGMA*
Ga0137383_1022288613300012199Vadose Zone SoilMEYKIKSFIVGVKEVRRILCTTVYGQPARRAYDMGRKLSNNFMDLLK
Ga0137365_1013095623300012201Vadose Zone SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYNMGRKLSTGFMDLLKLRMG*
Ga0137363_1043226133300012202Vadose Zone SoilGVMKDKIKSLILGVKEARWLVCTTVHGQPARRAYEMGRKLSNGFMDLLKFRMG*
Ga0137362_1086808323300012205Vadose Zone SoilMKYKIKSFIVGVKEARRILCTTVYGEPARRAHDMGRKLSNGFMGLLKVGMA*
Ga0137379_1097879423300012209Vadose Zone SoilMKYKIKSFIVGVKEARRTLCTTVYGQPARRAYDMGKKLSNRFMDLLKVVQMA*
Ga0137377_1110662813300012211Vadose Zone SoilMKYKIKSFIIGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA*
Ga0137370_1000407733300012285Vadose Zone SoilMKYKLKSFIVGVKEARGILCTTAYGRPARKAYNMGRKLSNGFLGLLKLRMG*
Ga0137366_1099063913300012354Vadose Zone SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYNMGRKLS
Ga0137371_1130922713300012356Vadose Zone SoilAKGGRMKYKIKSFVLGLKEARRVWCTTVYGRPARSAYNMGRKLSTGFIDLLKLRIG*
Ga0137375_1105986913300012360Vadose Zone SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMG*
Ga0137404_1000820263300012929Vadose Zone SoilMKYKIKSFIIGVREARGRWCTTVYGRPARRSYDMGRKLSNWFLALLTSGMA*
Ga0137404_1001050843300012929Vadose Zone SoilMKYKIKSFVLGVKEARWILCTTVYGRSARMAYDMGRKLSNGFTGLLKVRMA*
Ga0137404_1003489273300012929Vadose Zone SoilMKDKIKSFILGVKEARRLVCTTVHGQPARKAYEMGRKLSNGFMDLLKFRMG*
Ga0137407_1001034413300012930Vadose Zone SoilMKYKIKSFIIGVREARGRWCTTVYGRPARRSYDMGRKLS
Ga0134110_1007662123300012975Grasslands SoilMKYKIKSFVLGVKEARWISCTTVYGRPARIAYDMGRKLSNGFTALLKVRLA*
Ga0134076_1021018213300012976Grasslands SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARSAYDIGRKLSNGLMDLL
Ga0134087_1043359113300012977Grasslands SoilMKYTIKSFIVGVKEARRMLCTTVHGRPARRAYDMGRKLSNGFMGLLKVGMA
Ga0134078_1016529423300014157Grasslands SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMGLLKVGM
Ga0134085_1000798123300015359Grasslands SoilMKYKIKSFIVGVKEGRRVACTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA*
Ga0134074_107660413300017657Grasslands SoilMKYSIKSFILGVKEAHWILCTTVYGQPARRAYDMGRKLSNGFTGLLKVRMS
Ga0066662_1179120513300018468Grasslands SoilMKYTIKSFILGAKEARSILCTTVYGRPARRAYDMGRKLSKGVMG
Ga0066669_1200128313300018482Grasslands SoilMKYQIISFIVGVKEARRVLCTTVYGRPAKRAYDMGRKLSNGFMGLLLKSGMV
Ga0193704_108052213300019867SoilMKYKIKSFVVGVKEARRILCTTVYGQPARRAYDMGRELSNSFMG
Ga0193705_100184243300019869SoilMKYKIKSFVVGVKEARRILCTTVYGQPARRAYDMGRKLSNSFMGLLKVGMA
Ga0193723_100939943300019879SoilMKYKIKSFIVGVKEARWILCTTVYGQPARRAYDMERKISNGFMDLLKVVGMA
Ga0193727_100480663300019886SoilMKYKIKSFMVGVKEARRILCTTVYGRPARKAYDMGRKLSNGLMGLLKVGMA
Ga0193729_103667413300019887SoilMKYTIKSFILGAKEARSILCTTVYGRPARKAYEMGRKLSKGFT
Ga0193735_102913713300020006SoilAARHFDAKGDQRMKYKIKSFVLGVKEARWILCTTVSGRPARTAYDIGRKLSNGFAGLLKVRMA
Ga0193753_1035704513300020034SoilMKYKIKSFILDVKEARRILCTAVHGRPARRAYNMG
Ga0179594_1038930913300020170Vadose Zone SoilMKYKIKSFIVGVKEARRILCTTVYGEPARRAHDMGR
Ga0209350_100459293300026277Grasslands SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA
Ga0209027_118784323300026300Grasslands SoilKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA
Ga0209468_1000448183300026306SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNRFMDLLKAGMA
Ga0209470_102037843300026324SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYNMGRKLSTGFMDLLKLRMG
Ga0209266_120877313300026327SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYNMGRKLSTGFMDLLKL
Ga0209266_127848813300026327SoilMKYKIISFIVGVKEARRVLCTTVYGRPAKRAYDMGRKLSNG
Ga0209375_101611053300026329SoilMKYKIKSFVLGVKEARWISCTTVYGRPARIAYDMGRKLSNGFTALLKVRLA
Ga0209473_100566123300026330SoilMKYTIKSFIVGVKEARRILCTTVHGRPARTAYDMGRKLSNGFMGLLKVGMA
Ga0209803_114831443300026332SoilMKYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLL
Ga0209377_130561213300026334SoilMKYKIKSFMLGVKEARRVLCTTVHGRPAGRAYDAGRRLSNGFTGLFKVRM
Ga0209808_111636833300026523SoilRKEMKYKIKSFIVGVKEARGILCTTAYGRPARKAYNMGRKLSNGFLGLLKLRMG
Ga0209378_101642673300026528SoilMEYKIKSFIVGVKEGRRVVCTTVYGRPARKAYDMGRKLSNGFMDLLKAGMA
Ga0209058_101404393300026536SoilMKYKIISFIVGVKEARRVLCTTVYGRPAKRAYDMGRKLSNGFMGLLLKSGMV
Ga0209056_1001492223300026538SoilMKYKIRSFILGVKEARRILCTTVYGQPARTAYDMGRKLSNGFIGILKSEMV
Ga0209056_1010160713300026538SoilMKYKIKSFVLGLKEARRVWCTTVYGRPARNAYDMGRKLSTGLMDLLKLRMG
Ga0209156_1037103913300026547SoilMKYTIKSFIVGVKEARRILCTTVHGRPARTAYDMGRKLSNGFMGLLK
Ga0209577_1070582733300026552SoilMKYTIKSFIVGVKEARRILCTTVQGRPARRAYDMGRKLSNGFVGLLKVG
Ga0209971_104562733300027682Arabidopsis Thaliana RhizosphereEMKYKIQSFIVGVKEARGILCTTVYGLPARKAYNMGRKLSNGFLGLLKLRMG
Ga0307312_1003290723300028828SoilMKYKIKKEGRRVVCNTVYGQPARKAYDIGRKLSNGFMDLLKAGMA
Ga0307278_1000525493300028878SoilMKYRIKSFILGVKEARRVSCTTVYGRPAGRAYDAGRKLSNGFTGLLKVRMT
Ga0075373_1156065413300030945SoilMKYKIKSFIVGVKEARGILCTTVYGRPAGKAYNMRRKL
Ga0170824_11651472213300031231Forest SoilMKYKIKSFVLGVKEARRRLCTTVHGGSARRAYDMGRKLSNGFTGL
Ga0307469_1228088213300031720Hardwood Forest SoilMKYSIKSFILGVKEAHWILCTTVYGRPARIAYDMGRKLSNGFTGLLKVR
Ga0310810_1004634943300033412SoilMKYKIQSFIVGVKEARGILCTTVYGLPARKAYNMGRKLSNGFLGLLKLRMG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.