Basic Information | |
---|---|
Family ID | F100882 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 40 residues |
Representative Sequence | KINSADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 6.86 % |
% of genes from short scaffolds (< 2000 bps) | 6.86 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (95.098 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (27.451 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.510 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.392 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF06791 | TMP_2 | 5.88 |
PF13550 | Phage-tail_3 | 4.90 |
PF09718 | Tape_meas_lam_C | 0.98 |
PF05367 | Phage_endo_I | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG5281 | Phage-related minor tail protein | Mobilome: prophages, transposons [X] | 5.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 95.10 % |
All Organisms | root | All Organisms | 4.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300007552|Ga0102818_1024405 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
3300009426|Ga0115547_1068166 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
3300010316|Ga0136655_1131935 | Not Available | 748 | Open in IMG/M |
3300017824|Ga0181552_10402048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300025083|Ga0208791_1075904 | Not Available | 549 | Open in IMG/M |
3300025151|Ga0209645_1146676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300028115|Ga0233450_10393073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 27.45% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.73% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.78% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.80% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.90% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.92% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.94% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.96% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.98% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.98% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.98% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.98% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.98% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.98% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.98% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.98% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.98% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.98% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000418 | Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1 | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300008963 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300016703 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018629 | Metatranscriptome of marine microbial communities from Baltic Sea - GS852_ls4 | Environmental | Open in IMG/M |
3300019739 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MG | Environmental | Open in IMG/M |
3300019741 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_6-7_MG | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300023501 | Saline water microbial communities from Ace Lake, Antarctica - #1159 | Environmental | Open in IMG/M |
3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
P_2C_Liq_1_UnCtyDRAFT_100144211 | 3300000418 | Enviromental | VKINSADVGVDGPTSRIINMSFVALYDSTEGTNLKITRPA* |
BBAY93_100301521 | 3300000973 | Macroalgal Surface | NPYTFLFPRIKINSADVGVDGPTSRMISCSFVALYDTTATATGTNLLITRTA* |
JGI20158J14315_100665844 | 3300001355 | Pelagic Marine | RVKINSADVGVDGPTSRIISLAFTALYDTTTTSNLKITRTD* |
Ga0074648_12265001 | 3300005512 | Saline Water And Sediment | NSADVGVDGPTSRIVNISFVALYDSTEGTNLSITRA* |
Ga0070722_104118972 | 3300005601 | Marine Sediment | MKFAFPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA* |
Ga0075466_11795302 | 3300006029 | Aqueous | KINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSS* |
Ga0098054_10670214 | 3300006789 | Marine | DVGVDGPTSRIITMSFVALYNTADDTNLVITRSS* |
Ga0075467_100494341 | 3300006803 | Aqueous | INSADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA* |
Ga0070750_101278441 | 3300006916 | Aqueous | ANAYTFLFPRVKINSADVGVDGPTSRIISLAFTALYDTTTASNLKITRTDS* |
Ga0098045_11445311 | 3300006922 | Marine | SADVGVDGPTSRIVSMEFVGLYDTGETSNMEITRTS* |
Ga0098050_10514593 | 3300006925 | Marine | RIKVNSADLGVDGPTSRIVNISFVALRDTTEATNLKITRS* |
Ga0098050_11475772 | 3300006925 | Marine | SNTLKFAFPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA* |
Ga0075469_100635931 | 3300007231 | Aqueous | ADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA* |
Ga0070747_11743771 | 3300007276 | Aqueous | VKINSADVGVDGPTSRMISMSFVALYDTTEGTNLKITRPV* |
Ga0070752_13900741 | 3300007345 | Aqueous | NTMKFAFPRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA* |
Ga0099846_10120661 | 3300007542 | Aqueous | INSADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA* |
Ga0099846_12501851 | 3300007542 | Aqueous | SADVGVDGPTSRVISLSFVALYNTADASNLVITRSA* |
Ga0102818_10244053 | 3300007552 | Estuarine | NGADVPVGGQTGSRIVQMPFVAIYDATEGTNFFINRPDST* |
Ga0070751_13568932 | 3300007640 | Aqueous | ADVGVDGPTSRILNISFVALYDSTESSNLVITRA* |
Ga0102825_10244671 | 3300007655 | Estuarine | GADVPVGGQTGSRMISIPFVAIYDATEGTNFMITRPDTTV* |
Ga0102951_12127431 | 3300007725 | Water | ADVNVTGPEGRFVEMSFVSLYDSTEDTNLKITRPA* |
Ga0102887_12804521 | 3300008961 | Estuarine | KVKINSADVGVDGPTSRIINLSFVSLYDSTEGSNLVITKQV* |
Ga0102930_10497413 | 3300008963 | Pond Water | PVDGQTSRIITLPFVALYDATTETNLMIQRPDTT* |
Ga0102829_10539064 | 3300009026 | Estuarine | KINSADVGVDGPTSRMITMSFVALYDSTEGTNLKITRPA* |
Ga0115552_11220581 | 3300009077 | Pelagic Marine | VKINSADVGVDGPTSRVISLGFTALFDTTTASNLKITRTDT* |
Ga0115547_10681664 | 3300009426 | Pelagic Marine | DVGVDGPTSRVISLSFVALYNTADASNLVITRSA* |
Ga0115562_12603822 | 3300009434 | Pelagic Marine | VKINSADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA* |
Ga0115546_10874491 | 3300009435 | Pelagic Marine | FPRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA* |
Ga0115563_10217611 | 3300009442 | Pelagic Marine | DVGVDGPTSRIISLSFTALYDTTLDTNLKIVRTPT* |
Ga0115572_100511271 | 3300009507 | Pelagic Marine | KVKINSADVGVDGPTSRMISMSFVALYDATEGTNLKITRTA* |
Ga0115567_100538134 | 3300009508 | Pelagic Marine | SADVGVDGPTSRMISMSFVALYDATEGTNLKITRTA* |
Ga0115100_110997051 | 3300009608 | Marine | AYTFQFPRVKINSADTGVDGPTSRMVTMSFVALRDTTEATNLKITRPS* |
Ga0098061_12833302 | 3300010151 | Marine | INSADTSVGGPESRMVECSFVALYDSTEATNLKITRPS* |
Ga0136655_10465531 | 3300010316 | Freshwater To Marine Saline Gradient | ADVPVDGGTGSRVITLPFVALYDATEGSNLVISRPDTSA* |
Ga0136655_11319352 | 3300010316 | Freshwater To Marine Saline Gradient | VDGGTGSRVISLPFVALYDATEGTNFYIERPDSNA* |
Ga0182088_11199521 | 3300016703 | Salt Marsh | INSADVGVDGPTSRIVNISFVALYDSTESSNLVITRA |
Ga0181431_10074534 | 3300017735 | Seawater | FPKVKINSADVGVDGPTSRMISMSFVALYDATEATNLKITRTS |
Ga0181433_10219691 | 3300017739 | Seawater | TLKFAFPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0181402_10418134 | 3300017743 | Seawater | NSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0181397_10023411 | 3300017744 | Seawater | KINSADVGVDGPTSRIVNLTFVALRDNSEDTNLRITRS |
Ga0181430_10115721 | 3300017772 | Seawater | VKINSADVGVDGPTSRMISMSFVALYDATEATNLKITRPS |
Ga0181394_10172711 | 3300017776 | Seawater | AKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0181380_12993881 | 3300017782 | Seawater | PRAKINSADVGVDGPTSRVISLSFVALYNTTDASNLVITRSA |
Ga0181424_103770322 | 3300017786 | Seawater | KFAFPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0181552_104020481 | 3300017824 | Salt Marsh | VKINSADVGVDGPTSRIITASFIALRDDTANTNLQITRSPDP |
Ga0181607_106529672 | 3300017950 | Salt Marsh | DVGVDGPTSRVISLSFVALYDSTEQSNLVITKPAA |
Ga0188875_10110501 | 3300018629 | Freshwater Lake | PRIKINSADVGVDGPGSRMITCSFVALYDTTATATGTNLLITRTS |
Ga0194012_10411261 | 3300019739 | Sediment | AKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
Ga0194020_10445401 | 3300019741 | Sediment | FPRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
Ga0206125_101717742 | 3300020165 | Seawater | ADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA |
Ga0206123_103016842 | 3300021365 | Seawater | TMEFFFPRCKINSADVGVDGPTSRIVNLTFVALRDSSEATNLRITRS |
Ga0213865_100253011 | 3300021373 | Seawater | AFPRAKINSADVGVDGPTSRVISMSFVALYDTTDASNLVITRSS |
Ga0212025_10294083 | 3300022057 | Aqueous | KVNSADVGVDGPLSRLITMSFVALYDSTEGTNFKISRPETA |
Ga0212023_10413621 | 3300022061 | Aqueous | DVPVDGGTGSRVITLPFVALYDATENTNFYINRPDSNA |
Ga0212024_11023261 | 3300022065 | Aqueous | PRCKINSADVGVDGPTSRIVSMEFVGLYDTDEASNMEITRTS |
Ga0196889_10623752 | 3300022072 | Aqueous | VKINSADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA |
Ga0224906_10172383 | 3300022074 | Seawater | AKINSADVGVDGPTSRVITMSFVALHNTTDASNLVITRSA |
Ga0196897_10297061 | 3300022158 | Aqueous | VGVDGPLSRLITMSFVGLYDSTEGTNFKISRPETA |
Ga0196905_11255212 | 3300022198 | Aqueous | FPRIKINSADVGVGGPESRMVECAFVGLYDTTEATNLKITRPA |
Ga0196901_10134751 | 3300022200 | Aqueous | KINSADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA |
Ga0224504_100403251 | 3300022308 | Sediment | PRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0255773_100084047 | 3300022925 | Salt Marsh | FPRAKINSADVGVDGPTSRVISMSFVALYNTADASNLVITRSA |
Ga0222686_10465061 | 3300023501 | Saline Water | KINSADVGVEGPTSRIISLSFTSLFDTTTSTNLKITRTDT |
Ga0228623_10437191 | 3300024267 | Seawater | MEFFFPRCKINSADVGVDGPTSRIVNLSFVALRDPTEATNLRITRS |
Ga0228663_10824422 | 3300024508 | Seawater | RCKINSADVGLEGPTSRIVNLSFVALRDPTEATNLRITRS |
(restricted) Ga0255047_106833362 | 3300024520 | Seawater | EGTPNTMEFFFPRCKINSADVGVDGPTSRVISLSFVALRDDTEETNLRITRT |
(restricted) Ga0255044_101706942 | 3300024529 | Seawater | FPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
(restricted) Ga0255044_101874761 | 3300024529 | Seawater | RVKINSADVGVDGPTSRMISMSFVALYDTTEGTNLKITRPS |
Ga0208920_10184211 | 3300025072 | Marine | NSADVGVGGPTSRIITMSFVALYNTADDTNLVITRSS |
Ga0208791_10759042 | 3300025083 | Marine | SADVGVDGPTSRIVSMEFVGLYDTGETSNMEITRTS |
Ga0208298_10403111 | 3300025084 | Marine | ADVGVDGPTSRVISLSFTSLFDTTTATNLKITRTDT |
Ga0208794_10450341 | 3300025093 | Marine | KINSADTSVGGPDSRMVECSFVSLYDSTEETNLKITRPS |
Ga0208013_10018641 | 3300025103 | Marine | KINSADVGVDGPNSRIINMSFVALYDSTEETNLKITRS |
Ga0208793_10733921 | 3300025108 | Marine | DVGVEGPLSRLITMSFVAIYDSTEGTNFKISRPETA |
Ga0209645_11466762 | 3300025151 | Marine | RAKINSADVGVDGPTSRVISLSFVALYNTTDASNLVITRSA |
Ga0208148_10214754 | 3300025508 | Aqueous | NTMKFAFPRAKINSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSA |
Ga0208303_10598453 | 3300025543 | Aqueous | NSADVGVDGPTSRVISMSFVALYNTTDASNLVITRSS |
Ga0209194_10637371 | 3300025632 | Pelagic Marine | PRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
Ga0209833_10671414 | 3300025641 | Pelagic Marine | TLEFFFPRCKINSADVGVDGPTSRVISLSFVALRDETEATNLRITRT |
Ga0208160_10730783 | 3300025647 | Aqueous | YIKINSADANVGGPEGRFVECSFVALYDATEESNLVIKRPDTT |
Ga0208428_10404231 | 3300025653 | Aqueous | NTMKFAFPRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
Ga0208795_10146944 | 3300025655 | Aqueous | SADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA |
Ga0208162_10689621 | 3300025674 | Aqueous | SKINSADTSVGGPDSRMVECSFVSLYDSTEETNLKITRPS |
Ga0208427_10112414 | 3300025771 | Aqueous | SADVGVDGPTSRVVSMSFVALYDTTEATNLKITRSA |
Ga0208545_10909122 | 3300025806 | Aqueous | TMEFFFPRCKINSADVGVDGPTSRVISMTFVALRDDTEETNLRITRT |
Ga0208545_11414572 | 3300025806 | Aqueous | RVEINSADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA |
Ga0209307_10075196 | 3300025832 | Pelagic Marine | KVKINSADVGVDGPTSRMVSMSFVALFDSTEATNLKITRPS |
Ga0208544_100356294 | 3300025887 | Aqueous | KINSADVGVDGPTSRMISMSFVALYDATEGTNLKITRPA |
Ga0208644_10597581 | 3300025889 | Aqueous | KINSADVGVDGPTSRVISMSFVALYNTADASNLVITRSA |
Ga0208442_10792842 | 3300027229 | Estuarine | VKINSADVGVDGPTSRMISLSFVALYDATEGTNLKITRPA |
Ga0208947_10574103 | 3300027553 | Marine | FFPRCKINSADVGVDGPTSRIVNLTFVALRDSSEATNLRITRS |
Ga0247723_100083832 | 3300028025 | Deep Subsurface Sediment | AYTFLFPRVKINSADVGVDGPTSRIIKMSFVSLFDTTQATNLKITRPA |
Ga0233450_103930732 | 3300028115 | Salt Marsh | AFPRAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
Ga0247567_11354731 | 3300028338 | Seawater | FFFPRCKINSADVGVDGPTSRIVNLSFVALRDPTEATNLRITRS |
Ga0308021_102356481 | 3300031141 | Marine | EFFFPRCKINSADVGVDGPTSRMIAMSFVALRDDTEATSLRITRS |
Ga0307488_100045831 | 3300031519 | Sackhole Brine | SADVGVDGPTSRIVNLSFVALRDSTEATNLRITRS |
Ga0307488_107941942 | 3300031519 | Sackhole Brine | DVGVDGPTSRIISLSFTSLFDTTTSTNLKITRTDT |
Ga0302114_103023082 | 3300031621 | Marine | ADVGVDGPTSRIISLSFTSLFDTTTSTNLKITRTDT |
Ga0302121_100553244 | 3300031626 | Marine | NSADVGVDGPTSRVISMSFTALYDTTANTNLKIVRTPFT |
Ga0307984_10800771 | 3300031658 | Marine | NSADVGVDGPTSRMVTMSFVALFDSTLGTNLQITRPT |
Ga0307998_10401424 | 3300031702 | Marine | FDFPRVKINSADVGVDGPTSRMVTMSFVALFDSTLGTNLQITRPT |
Ga0348337_023772_2_127 | 3300034418 | Aqueous | RAKINSADVGVDGPTSRVISLSFVALYNTADASNLVITRSA |
⦗Top⦘ |