Metagenome / Metatranscriptome Family F101042

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F101042
Family Type	Metagenome / Metatranscriptome
Number of Sequences	102
Average Sequence Length	39 residues
Representative Sequence	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA
Number of Associated Samples	70
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	34.31 %
% of genes near scaffold ends (potentially truncated)	26.47 %
% of genes from short scaffolds (< 2000 bps)	69.61 %
Associated GOLD sequencing projects	63
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (59.804 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (29.412 % of family members)
Environment Ontology (ENVO)	Unclassified (78.431 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (86.275 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.17
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF00313	CSD	26.47
PF00578	AhpC-TSA	7.84
PF07437	YfaZ	6.86
PF13505	OMP_b-brl	4.90
PF02915	Rubrerythrin	4.90
PF04304	DUF454	3.92
PF05488	PAAR_motif	3.92
PF07012	Curlin_rpt	1.96
PF13759	2OG-FeII_Oxy_5	1.96
PF03401	TctC	0.98
PF00301	Rubredoxin	0.98
PF00149	Metallophos	0.98
PF12849	PBP_like_2	0.98
PF09694	Gcw_chp	0.98
PF05221	AdoHcyase	0.98
PF13946	DUF4214	0.98
PF00085	Thioredoxin	0.98
PF10417	1-cysPrx_C	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG2832	Uncharacterized membrane protein YbaN, DUF454 family	Function unknown [S]	3.92
COG4104	Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion	Intracellular trafficking, secretion, and vesicular transport [U]	3.92
COG0499	S-adenosylhomocysteine hydrolase	Coenzyme transport and metabolism [H]	0.98
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
All Organisms	root	All Organisms	40.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
Viruses	superkingdom	All Organisms → Viruses	23.53 %
cellular organisms	root	All Organisms → cellular organisms	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	20.59 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	16.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	20.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	13.73 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	20.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.96 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20.59 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.98 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.98 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	17.65 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.98 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.98 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.65 %
Rhizobiales bacterium TMED143	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Janthinobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium	0.98 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.98 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.65 %
Rhizobiales bacterium TMED143	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Janthinobacterium agaricidamnosum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum	0.98 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.98 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.80 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.65 %
Rhizobiales bacterium TMED143	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	3.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.94 %
Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum → Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628	0.98 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.98 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.98 %
bacterium TMED46	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035265000\|ErSWdraf_F5BXKTZ02HPAOS	Not Available	508	Open in IMG/M
3300001605\|Draft_10029772	Not Available	4926	Open in IMG/M
3300002835\|B570J40625_100390154	Not Available	1359	Open in IMG/M
3300003277\|JGI25908J49247_10017514	Not Available	2162	Open in IMG/M
3300004793\|Ga0007760_11388063	Not Available	769	Open in IMG/M
3300005517\|Ga0070374_10066561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1877	Open in IMG/M
3300005517\|Ga0070374_10284822	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46	840	Open in IMG/M
3300005525\|Ga0068877_10701696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	542	Open in IMG/M
3300005527\|Ga0068876_10185001	Not Available	1213	Open in IMG/M
3300005581\|Ga0049081_10054819	Not Available	1507	Open in IMG/M
3300005662\|Ga0078894_10019426	All Organisms → cellular organisms → Bacteria	5472	Open in IMG/M
3300005662\|Ga0078894_10055493	All Organisms → cellular organisms → Bacteria → Proteobacteria	3372	Open in IMG/M
3300005662\|Ga0078894_10057367	Not Available	3320	Open in IMG/M
3300005662\|Ga0078894_10141094	Not Available	2157	Open in IMG/M
3300005662\|Ga0078894_10401530	Not Available	1238	Open in IMG/M
3300005662\|Ga0078894_10470036	Not Available	1131	Open in IMG/M
3300006639\|Ga0079301_1083275	Not Available	995	Open in IMG/M
3300008052\|Ga0102893_1070514	Not Available	1049	Open in IMG/M
3300008113\|Ga0114346_1269390	Not Available	615	Open in IMG/M
3300008116\|Ga0114350_1019882	Not Available	5258	Open in IMG/M
3300008120\|Ga0114355_1023155	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4771	Open in IMG/M
3300009068\|Ga0114973_10348732	Not Available	782	Open in IMG/M
3300009152\|Ga0114980_10484864	Not Available	705	Open in IMG/M
3300009155\|Ga0114968_10091978	Not Available	1866	Open in IMG/M
3300009158\|Ga0114977_10029795	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3421	Open in IMG/M
3300009158\|Ga0114977_10269640	Not Available	977	Open in IMG/M
3300009158\|Ga0114977_10443742	Not Available	717	Open in IMG/M
3300009159\|Ga0114978_10030934	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3825	Open in IMG/M
3300009159\|Ga0114978_10051836	All Organisms → cellular organisms → Bacteria → Proteobacteria	2829	Open in IMG/M
3300009159\|Ga0114978_10088258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	2064	Open in IMG/M
3300009160\|Ga0114981_10257965	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	949	Open in IMG/M
3300009164\|Ga0114975_10021396	All Organisms → cellular organisms → Bacteria → Proteobacteria	3921	Open in IMG/M
3300009164\|Ga0114975_10099395	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1683	Open in IMG/M
3300009164\|Ga0114975_10100096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1676	Open in IMG/M
3300009164\|Ga0114975_10177653	Not Available	1209	Open in IMG/M
3300009180\|Ga0114979_10426617	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	773	Open in IMG/M
3300009183\|Ga0114974_10000626	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	29035	Open in IMG/M
3300009419\|Ga0114982_1124825	Not Available	794	Open in IMG/M
3300010885\|Ga0133913_10121269	Not Available	7007	Open in IMG/M
3300010885\|Ga0133913_11044322	Not Available	2109	Open in IMG/M
3300012346\|Ga0157141_1049582	Not Available	517	Open in IMG/M
3300013004\|Ga0164293_10054565	All Organisms → cellular organisms → Bacteria → Proteobacteria	3206	Open in IMG/M
3300013004\|Ga0164293_10212497	Not Available	1389	Open in IMG/M
3300013005\|Ga0164292_10026154	All Organisms → cellular organisms → Bacteria	4728	Open in IMG/M
3300013006\|Ga0164294_10098810	Not Available	2167	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10003327	Not Available	21001	Open in IMG/M
3300018868\|Ga0187844_10108167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1248	Open in IMG/M
3300020141\|Ga0211732_1137099	Not Available	671	Open in IMG/M
3300020141\|Ga0211732_1292597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	1196	Open in IMG/M
3300020141\|Ga0211732_1499556	Not Available	505	Open in IMG/M
3300020151\|Ga0211736_10232088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4168	Open in IMG/M
3300020151\|Ga0211736_10322387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	1260	Open in IMG/M
3300020151\|Ga0211736_10671560	All Organisms → cellular organisms → Bacteria → Proteobacteria	3119	Open in IMG/M
3300020151\|Ga0211736_10849569	Not Available	639	Open in IMG/M
3300020159\|Ga0211734_10653025	Not Available	627	Open in IMG/M
3300020159\|Ga0211734_11028088	All Organisms → cellular organisms → Bacteria → Proteobacteria	2370	Open in IMG/M
3300020160\|Ga0211733_10777732	Not Available	1529	Open in IMG/M
3300020160\|Ga0211733_10906868	Not Available	957	Open in IMG/M
3300020161\|Ga0211726_10008035	Not Available	527	Open in IMG/M
3300020161\|Ga0211726_10032658	Not Available	673	Open in IMG/M
3300020161\|Ga0211726_10340560	All Organisms → Viruses → Predicted Viral	1691	Open in IMG/M
3300020162\|Ga0211735_10935985	Not Available	735	Open in IMG/M
3300020162\|Ga0211735_11129316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium TMED143	1618	Open in IMG/M
3300020162\|Ga0211735_11138558	Not Available	922	Open in IMG/M
3300020172\|Ga0211729_10171849	Not Available	796	Open in IMG/M
3300021438\|Ga0213920_1050831	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	862	Open in IMG/M
3300021961\|Ga0222714_10179164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1242	Open in IMG/M
3300021962\|Ga0222713_10358977	Not Available	909	Open in IMG/M
3300021963\|Ga0222712_10484090	Not Available	735	Open in IMG/M
3300021964\|Ga0222719_10341620	Not Available	953	Open in IMG/M
3300022407\|Ga0181351_1122122	Not Available	975	Open in IMG/M
3300022594\|Ga0236340_1002518	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7616	Open in IMG/M
3300024350\|Ga0255167_1025033	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1136	Open in IMG/M
3300027144\|Ga0255102_1043643	Not Available	731	Open in IMG/M
3300027146\|Ga0255104_1040235	Not Available	807	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1083586	All Organisms → Viruses → Predicted Viral	1616	Open in IMG/M
3300027733\|Ga0209297_1202530	Not Available	786	Open in IMG/M
3300027733\|Ga0209297_1317845	Not Available	575	Open in IMG/M
3300027734\|Ga0209087_1330087	Not Available	533	Open in IMG/M
3300027759\|Ga0209296_1001567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	17354	Open in IMG/M
3300027759\|Ga0209296_1012594	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5012	Open in IMG/M
3300027759\|Ga0209296_1089548	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1495	Open in IMG/M
3300027763\|Ga0209088_10216342	Not Available	812	Open in IMG/M
3300027782\|Ga0209500_10025035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3423	Open in IMG/M
3300027793\|Ga0209972_10040557	All Organisms → cellular organisms → Bacteria → Proteobacteria	2606	Open in IMG/M
3300027798\|Ga0209353_10066233	Not Available	1649	Open in IMG/M
3300027805\|Ga0209229_10194294	Not Available	910	Open in IMG/M
3300027836\|Ga0209230_10023797	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2990	Open in IMG/M
3300027963\|Ga0209400_1124071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum → Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628	1163	Open in IMG/M
3300027963\|Ga0209400_1137270	Not Available	1083	Open in IMG/M
3300027969\|Ga0209191_1053608	Not Available	1835	Open in IMG/M
3300027969\|Ga0209191_1065217	Not Available	1625	Open in IMG/M
(restricted) 3300027977\|Ga0247834_1159079	Not Available	902	Open in IMG/M
(restricted) 3300028114\|Ga0247835_1012997	Not Available	5167	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10084381	All Organisms → Viruses → Predicted Viral	2182	Open in IMG/M
3300032050\|Ga0315906_10362959	Not Available	1277	Open in IMG/M
3300034020\|Ga0335002_0474510	Not Available	675	Open in IMG/M
3300034062\|Ga0334995_0301302	Not Available	1050	Open in IMG/M
3300034102\|Ga0335029_0261263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1113	Open in IMG/M
3300034102\|Ga0335029_0322794	Not Available	964	Open in IMG/M
3300034106\|Ga0335036_0553113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	707	Open in IMG/M
3300034108\|Ga0335050_0118684	Not Available	1497	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.02%
Engineered	Engineered	0.98%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.06%
Terrestrial	Environmental → Terrestrial	1.96%
Wastewater	Engineered → Wastewater	0.98%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	92.16%
Marine	Environmental → Aquatic → Marine	4.90%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.96%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.98%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	66.67%
Lentic	Environmental → Aquatic → Freshwater → Lentic	19.61%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.92%
River	Environmental → Aquatic → Freshwater → River	2.94%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.96%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.98%
Creek	Environmental → Aquatic → Freshwater → Creek	0.98%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.98%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	66.67%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	18.63%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.92%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.94%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.96%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.98%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.98%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.98%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	29.41%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	19.61%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	14.71%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	14.71%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	3.92%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.94%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.94%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.96%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.96%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.98%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.98%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.98%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.98%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.98%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.98%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.98%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035265000	Freshwater microbial communities from Swedish Lakes - surface of Lake Erken	Environmental	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300004793	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300008052	Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012346	Freshwater microbial communities from Emily Creek, Ontario, Canada - S29	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300018868	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300021438	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300021964	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022594	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1	Environmental	Open in IMG/M
3300024350	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d	Environmental	Open in IMG/M
3300027144	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h	Environmental	Open in IMG/M
3300027146	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027977 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m	Environmental	Open in IMG/M
3300028114 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m	Environmental	Open in IMG/M
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300034020	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ErSWdraft_3880240	2035265000	Freshwater	MTVNQANKVNANADTFDFSAMSFTGNTVANDSRFALAA
Draft_100297725	3300001605	Hydrocarbon Resource Environments	MGSTRQAIVVNEAKLVNANADTFDFSAMSFSGNTVGGKVALAA*
B570J40625_1003901543	3300002835	Freshwater	MTLNQAKQVNAENADTFDFTAMSFTGNTVTGSSKVALAA*
JGI25908J49247_100175144	3300003277	Freshwater Lake	MTVNQAKLVNANADTYDFSAMSFTGNTVRGAANESRFALAA*
Ga0007760_113880631	3300004793	Freshwater Lake	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0070374_100665612	3300005517	Freshwater Lake	MTVNQANKVKANADTFEFGAMSFTGNTVSGKSKFALAA*
Ga0070374_102848222	3300005517	Freshwater Lake	MTVNQAKLVNANANTTEFSGFSFTGNTVRGAANEGRFALAA*
Ga0068877_107016961	3300005525	Freshwater Lake	MTVNQANKVKANADTFEFGALNFTGNTVRGAANEGRFALAA*
Ga0068876_101850013	3300005527	Freshwater Lake	MTVNQAKIVNANADTFDFSAMSFTGNTVSGKSKVALAA*
Ga0049081_100548194	3300005581	Freshwater Lentic	MTVNQANKVKANADTFDFSAMSFTGNTVRGAANESRF
Ga0078894_1001942610	3300005662	Freshwater Lake	MTVNQAFINAEENAFDFAAMSFTGNTVKGSKVAVAA*
Ga0078894_100554938	3300005662	Freshwater Lake	MTVNQANKVKANADTFEFGAMSFTGNTVSGKSKVALAA*
Ga0078894_100573671	3300005662	Freshwater Lake	MDVIQAKNVNANADTFDFSAMSFSGNTVRGEVALAA*
Ga0078894_101410943	3300005662	Freshwater Lake	MTVNQANKVKANADTFEFGAMSFTGNTVSGTSRFALAA*
Ga0078894_104015303	3300005662	Freshwater Lake	NVNATADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0078894_104700361	3300005662	Freshwater Lake	MTVNQAKNVNANADTFDFSAMSFTGNSVSGKSKVALAA*
Ga0079301_10832752	3300006639	Deep Subsurface	MTVNQANKVKANADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0102893_10705141	3300008052	Estuarine	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANESR
Ga0114346_12693902	3300008113	Freshwater, Plankton	MTVNQANKVKANADTFDFSAMSFTGNTVSGKSKVALAA*
Ga0114350_10198828	3300008116	Freshwater, Plankton	MTVNQANKVKANADTFEFGAMSLTGNTVSGKSKVALAA*
Ga0114355_10231558	3300008120	Freshwater, Plankton	MTVNQAKLVNAKADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0114973_103487323	3300009068	Freshwater Lake	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANESRFAL
Ga0114980_104848642	3300009152	Freshwater Lake	MTVNQANKVNAKADTFDFSAMSFTGNSVTGASKFALAA*
Ga0114968_100919782	3300009155	Freshwater Lake	MTVNQAKLVNANADTFDFSAMSFTGNSVSGKSKVALAA*
Ga0114977_100297952	3300009158	Freshwater Lake	MTANQANKVNANADTFEFSGFNFTGNTVRGAANEGRFALAA*
Ga0114977_102696401	3300009158	Freshwater Lake	MTVNQAKIVNATADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0114977_104437422	3300009158	Freshwater Lake	ANKVNANADTFEFSGFNFTGNTVRGAANEGRFALAA*
Ga0114978_100309341	3300009159	Freshwater Lake	MTANQANKVNANADTFEFSGFNFTGNTVRGAANEGR
Ga0114978_100518366	3300009159	Freshwater Lake	MTVNQANKVKANADTFDFSAMSFTGNTVRGAANDSRFALAA*
Ga0114978_100882583	3300009159	Freshwater Lake	MTVNQANQVNAKADTFDFSAMSFTGNSVTGASKVALAA*
Ga0114981_102579651	3300009160	Freshwater Lake	NQAKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA*
Ga0114975_100213967	3300009164	Freshwater Lake	MTVNQAKLVNANADTFEFSGFNFTGNTVRGAANEGRFALAA*
Ga0114975_100993954	3300009164	Freshwater Lake	MTVNQANKVKANADTFEFSAMSFTGNTVTGKSKVALAA*
Ga0114975_101000963	3300009164	Freshwater Lake	MTVNQANKVKANADTNDFTAMSFTGNTVSGKSKVALAA*
Ga0114975_101776531	3300009164	Freshwater Lake	MTVNQAKIVNANANTNDFTAMSFTGNTVRGAANESRFALAA*
Ga0114979_104266172	3300009180	Freshwater Lake	IQAKIVNANADTFDFTAMSFTGNSVTGKSKTALAA*
Ga0114974_1000062631	3300009183	Freshwater Lake	MTVNQAKIVNANADTFDFTAMSFTGNTVRGAANESKFALAA*
Ga0114982_11248252	3300009419	Deep Subsurface	MTVNQAKLVNANADTFDFSAMSFTGNTVSGKSKVALAA*
Ga0133913_101212699	3300010885	Freshwater Lake	MTVNQAKIVNANANTTDFTAMSFTGNSVTGKSKTALAA*
Ga0133913_110443221	3300010885	Freshwater Lake	QANKVNANADTFEFSGFNFTGNTVRGAANEGRFALAA*
Ga0157141_10495821	3300012346	Freshwater	MTVNQANKVNANADTFDFSAMSFSGNTVGGKVALAA*
Ga0164293_100545654	3300013004	Freshwater	MTVNQAKTVNAEKADTFDFTAMSFTGNTVSGKSKVALAA*
Ga0164293_102124972	3300013004	Freshwater	MDVIQAKTVNAEKADTFDFTAMSFTGNTVRGAANVSRFALAA*
Ga0164292_100261544	3300013005	Freshwater	MTLNQAKQVNAENADTFDFTAMSFTGNTVSGKSKVALAA*
Ga0164294_100988104	3300013006	Freshwater	MTVNQAKNVNATADTFDFSAMSFTGNTVRGAANESRFALAA*
(restricted) Ga0172367_100033276	3300013126	Freshwater	MTLNQANKVKANADTFDFTAMSFTGNTVANDSRFALAA*
Ga0187844_101081673	3300018868	Freshwater	MTVNQAKNVNATADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0211732_11370992	3300020141	Freshwater	MDVIQAKTVNAEKADTFDFTAMSFTGNTVRGAANVSRFALAA
Ga0211732_12925971	3300020141	Freshwater	MTVNQANKVNAKADTFDFSAMSFTGNSVTGASKFALAA
Ga0211732_14995561	3300020141	Freshwater	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0211736_102320882	3300020151	Freshwater	MTLNQAKQVNAEKADTFDFTAMSFTGNTVTGSSKIAFAA
Ga0211736_103223871	3300020151	Freshwater	MTVNQANKVKANADTFEFGAMSFTGNTVRGAANEGRFALAA
Ga0211736_106715601	3300020151	Freshwater	MTVNQAKIVNANADTFDFSAMSFTGNSVTGASKVALAA
Ga0211736_108495692	3300020151	Freshwater	AMTVNQANKVKANADTFDFSAMSFTGNTVSGKSKVALAA
Ga0211734_106530251	3300020159	Freshwater	MTVNQAKIVNANADTTEFSGFSFTGNTVRGAANEGRFALAA
Ga0211734_110280885	3300020159	Freshwater	MTVNQANKVKANADTFDFSAMSFTGNTVSGKSKVALAA
Ga0211733_107777322	3300020160	Freshwater	MTVNQAKLVNANADTFDFSAMSFTGNTVRGAANDSRFALAA
Ga0211733_109068682	3300020160	Freshwater	MTVNQASKVKANADTFEFSAFGFTGNTVRGAANEGRFALAA
Ga0211726_100080351	3300020161	Freshwater	AKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0211726_100326582	3300020161	Freshwater	MDVIQAKKVKANADTFDFTAMSFTGNTVSGKSKVAVAA
Ga0211726_103405601	3300020161	Freshwater	MTVNQANQVNANADTFDFSAMSFTGNSVTGASKVALAA
Ga0211735_109359851	3300020162	Freshwater	NQAKLVNANADTFDFSAMSFTGNSVTGASKFALAA
Ga0211735_111293161	3300020162	Freshwater	MTVNQAKLVNANADTFDFSAMSFTGNSVTGASKFAL
Ga0211735_111385581	3300020162	Freshwater	REAMDVIQAKKVKANADTFDFTAMSFTGNTVSGTSKVAVAA
Ga0211729_101718492	3300020172	Freshwater	MDVIQAKKVKANADTFDFTAMSFTGNTVSGKSKVALAA
Ga0213920_10508311	3300021438	Freshwater	MTVNQAKIVNANADTFDFGAMSFTGNSVSGKSKVALAA
Ga0222714_101791641	3300021961	Estuarine Water	MTVNQAKNVNANADTFDFSAMSFTGNSVSGKSKVALAA
Ga0222713_103589772	3300021962	Estuarine Water	MTVNQANKVKANADTFEFGAMSFTGNSVTGASRFALAA
Ga0222712_104840901	3300021963	Estuarine Water	MTVNQAKLVNANADTFDFSAMSFTGNTVSGKSKVALAA
Ga0222719_103416202	3300021964	Estuarine Water	TGQATDLISAKQVNAEDADTFEFGALSFTGNTVGGEVALAA
Ga0181351_11221223	3300022407	Freshwater Lake	MTVNQAKIVNANADTFDFSAMSFSGNTVGGKVALAA
Ga0236340_100251810	3300022594	Freshwater	MTVNQANNVNANADTFEFGAMSFTGNSVAGKSKVALAA
Ga0255167_10250333	3300024350	Freshwater	MTLNQANKVIANDDSFDVGAISFTGNTVRGAANESRFALAA
Ga0255102_10436431	3300027144	Freshwater	MTVNQAKLVNANADTFEFGAMSFTGNTVSGKSKFALAA
Ga0255104_10402352	3300027146	Freshwater	NQANKVKANADTFDFSAMSFTGNTVRGAANESRFALAA
(restricted) Ga0247836_10835862	3300027728	Freshwater	MTVNQANKVKANADTFEFGALNFTGNTVRGAANEGRFALAA
Ga0209297_12025301	3300027733	Freshwater Lake	QAKLVNANADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0209297_13178451	3300027733	Freshwater Lake	MTANQANKVNANADTFEFSGFNFTGNTVRGAANEGRFALAA
Ga0209087_13300872	3300027734	Freshwater Lake	MTVNQANKVKANADTNDFTAMSFTGNTVSGKSKVALAA
Ga0209296_10015672	3300027759	Freshwater Lake	MTVNQAKIVNANADTFDFTAMSFTGNTVRGAANESKFALAA
Ga0209296_101259410	3300027759	Freshwater Lake	MTVNQAKIVNANANTTDFTAMSFTGNSVTGKSKTALAA
Ga0209296_10895483	3300027759	Freshwater Lake	MTVNQANKVKANADTFEFSAMSFTGNTVTGKSKVALAA
Ga0209088_102163422	3300027763	Freshwater Lake	MTVNQANKVKANADTFDFSAMSFTGNTVRGAANDSRFALAA
Ga0209500_100250352	3300027782	Freshwater Lake	MTVNQANQVNAKADTFDFSAMSFTGNSVTGASKVALAA
Ga0209972_100405575	3300027793	Freshwater Lake	MTVNQANKVKANADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0209353_100662335	3300027798	Freshwater Lake	AMTVNQANKVKANADTFEFGAMSFTGNTVSGKSKFALAA
Ga0209229_101942942	3300027805	Freshwater And Sediment	MTVNQAKLVNANADTFEFSAMSFTGNTVSGKSKFALAA
Ga0209230_100237976	3300027836	Freshwater And Sediment	MTVNQAKLVNANADTFDLSAMSFTGNTVRGAANESRFAL
Ga0209400_11240713	3300027963	Freshwater Lake	MTVNQAKLVNATADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0209400_11372702	3300027963	Freshwater Lake	MTVNQAKLVNANADTFDFSAMSFTGNSVSGKSKVALAA
Ga0209191_10536081	3300027969	Freshwater Lake	NKVNANADTFEFSGFNFTGNTVRGAANEGRFALAA
Ga0209191_10652174	3300027969	Freshwater Lake	MTVNQAKLVNANADTFEFSGFNFTGNTVRGAANEGRFALAA
(restricted) Ga0247834_11590792	3300027977	Freshwater	MTVNQAKQVNAEKADTFDFTAMSFTGNTVSGKSKVAVAA
(restricted) Ga0247835_10129971	3300028114	Freshwater	AMTVNQANKVKANADTFEFGALNFTGNTVRGAANEGRFALAA
(restricted) Ga0247840_100843811	3300028581	Freshwater	MTVNQAKLVNANANTTEFSGFSFTGNTVRGAANEGRFALA
Ga0315906_103629593	3300032050	Freshwater	NQAKLVNANADTFDFSAMSFTGNTVSGKSKVALAA
Ga0335002_0474510_490_615	3300034020	Freshwater	MTVNQAKHVNANANTFDFSAMSFTGNTVRGAANESRFALAA
Ga0334995_0301302_50_169	3300034062	Freshwater	MTLNQAKQVNAENADTFDFTAMSFTGNTVSGKSKVALAA
Ga0335029_0261263_1004_1111	3300034102	Freshwater	INVNAKADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0335029_0322794_774_893	3300034102	Freshwater	MTVNQAKTVNAEKADTFDFTAMSFTGNTVTGSSKVAFAA
Ga0335036_0553113_585_707	3300034106	Freshwater	PLIKQINVNAKADTFDFSAMSFTGNTVRGAANESRFALAA
Ga0335050_0118684_1335_1460	3300034108	Freshwater	MTVNQAKHVNATADTFDFSAMSFTGNTVRGAANESRFALAA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters