Basic Information | |
---|---|
Family ID | F101410 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 43 residues |
Representative Sequence | GRALGLVRELAGFTARGQAPPADLEPLVDAVRAGRFARAALPGP |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.22 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.451 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.451 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.235 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF02574 | S-methyl_trans | 20.59 |
PF07702 | UTRA | 15.69 |
PF00392 | GntR | 12.75 |
PF00221 | Lyase_aromatic | 10.78 |
PF02894 | GFO_IDH_MocA_C | 8.82 |
PF13344 | Hydrolase_6 | 6.86 |
PF13193 | AMP-binding_C | 4.90 |
PF00496 | SBP_bac_5 | 2.94 |
PF00743 | FMO-like | 2.94 |
PF05988 | DUF899 | 0.98 |
PF12697 | Abhydrolase_6 | 0.98 |
PF09286 | Pro-kuma_activ | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 20.59 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 20.59 |
COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 10.78 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 8.82 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 2.94 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.98 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.45 % |
Unclassified | root | N/A | 22.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_104538678 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005332|Ga0066388_101584072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 1151 | Open in IMG/M |
3300005332|Ga0066388_103709869 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005335|Ga0070666_10088997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2118 | Open in IMG/M |
3300005337|Ga0070682_100924022 | Not Available | 719 | Open in IMG/M |
3300005435|Ga0070714_101227362 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005437|Ga0070710_10599202 | Not Available | 767 | Open in IMG/M |
3300005467|Ga0070706_101955969 | Not Available | 531 | Open in IMG/M |
3300005471|Ga0070698_101437774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300005518|Ga0070699_101411435 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005530|Ga0070679_100456382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1222 | Open in IMG/M |
3300005543|Ga0070672_100242059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1518 | Open in IMG/M |
3300005548|Ga0070665_102451905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300005615|Ga0070702_101081754 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005764|Ga0066903_108748799 | Not Available | 514 | Open in IMG/M |
3300006237|Ga0097621_100026982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4512 | Open in IMG/M |
3300006581|Ga0074048_13389994 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
3300006755|Ga0079222_10435746 | Not Available | 930 | Open in IMG/M |
3300006806|Ga0079220_11921904 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300006880|Ga0075429_101383216 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300009098|Ga0105245_12472609 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300009101|Ga0105247_11393563 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010048|Ga0126373_12180874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 615 | Open in IMG/M |
3300010329|Ga0134111_10347061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 627 | Open in IMG/M |
3300010358|Ga0126370_10091686 | Not Available | 2076 | Open in IMG/M |
3300010359|Ga0126376_11609181 | Not Available | 682 | Open in IMG/M |
3300010361|Ga0126378_10017778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6046 | Open in IMG/M |
3300010362|Ga0126377_10846507 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300010373|Ga0134128_10064365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4218 | Open in IMG/M |
3300010376|Ga0126381_102089256 | Not Available | 816 | Open in IMG/M |
3300010376|Ga0126381_104267007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 554 | Open in IMG/M |
3300010398|Ga0126383_10184982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1984 | Open in IMG/M |
3300010399|Ga0134127_11358142 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300010863|Ga0124850_1151689 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300011271|Ga0137393_10328201 | Not Available | 1305 | Open in IMG/M |
3300012201|Ga0137365_11273474 | Not Available | 523 | Open in IMG/M |
3300012203|Ga0137399_10360552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1208 | Open in IMG/M |
3300012206|Ga0137380_10301915 | Not Available | 1434 | Open in IMG/M |
3300012356|Ga0137371_10313541 | Not Available | 1221 | Open in IMG/M |
3300012359|Ga0137385_11087624 | Not Available | 658 | Open in IMG/M |
3300012473|Ga0157340_1002591 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300012515|Ga0157338_1003050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1361 | Open in IMG/M |
3300012948|Ga0126375_10615159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 832 | Open in IMG/M |
3300012958|Ga0164299_10029640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2363 | Open in IMG/M |
3300012958|Ga0164299_10806148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 670 | Open in IMG/M |
3300015372|Ga0132256_100821251 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300016294|Ga0182041_10486649 | Not Available | 1067 | Open in IMG/M |
3300016357|Ga0182032_11689938 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300016387|Ga0182040_10335472 | Not Available | 1167 | Open in IMG/M |
3300017974|Ga0187777_10201634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 1341 | Open in IMG/M |
3300017974|Ga0187777_10855210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 652 | Open in IMG/M |
3300017999|Ga0187767_10385751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 502 | Open in IMG/M |
3300018058|Ga0187766_10699563 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300020000|Ga0193692_1103069 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300020070|Ga0206356_11566909 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300020583|Ga0210401_10159635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2106 | Open in IMG/M |
3300021178|Ga0210408_11000566 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300021420|Ga0210394_10490416 | Not Available | 1081 | Open in IMG/M |
3300021420|Ga0210394_11510863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 568 | Open in IMG/M |
3300021479|Ga0210410_10224328 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300021479|Ga0210410_11528425 | Not Available | 560 | Open in IMG/M |
3300021560|Ga0126371_12447035 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300024283|Ga0247670_1020246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
3300025735|Ga0207713_1083073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
3300025906|Ga0207699_10255163 | Not Available | 1210 | Open in IMG/M |
3300025916|Ga0207663_10284020 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300025916|Ga0207663_11354342 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300025927|Ga0207687_11187802 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300026067|Ga0207678_11941336 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300027401|Ga0208637_1034774 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027512|Ga0209179_1058850 | Not Available | 832 | Open in IMG/M |
3300028379|Ga0268266_10307077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
3300028828|Ga0307312_10218518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
3300031231|Ga0170824_100828496 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300031469|Ga0170819_17847001 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300031543|Ga0318516_10649659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 600 | Open in IMG/M |
3300031545|Ga0318541_10614484 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031723|Ga0318493_10263695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
3300031723|Ga0318493_10277909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300031724|Ga0318500_10072636 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300031769|Ga0318526_10071302 | Not Available | 1358 | Open in IMG/M |
3300031781|Ga0318547_10179454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 1258 | Open in IMG/M |
3300031793|Ga0318548_10196006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 991 | Open in IMG/M |
3300031797|Ga0318550_10278144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 812 | Open in IMG/M |
3300031798|Ga0318523_10015832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3181 | Open in IMG/M |
3300031798|Ga0318523_10226344 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300031805|Ga0318497_10433479 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300031819|Ga0318568_10440084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
3300031831|Ga0318564_10327388 | Not Available | 674 | Open in IMG/M |
3300031833|Ga0310917_10035304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2987 | Open in IMG/M |
3300031845|Ga0318511_10158742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 991 | Open in IMG/M |
3300031893|Ga0318536_10143616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1211 | Open in IMG/M |
3300031945|Ga0310913_10633652 | Not Available | 757 | Open in IMG/M |
3300031981|Ga0318531_10029019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2260 | Open in IMG/M |
3300032174|Ga0307470_10148392 | Not Available | 1430 | Open in IMG/M |
3300032174|Ga0307470_11438753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 570 | Open in IMG/M |
3300032828|Ga0335080_12224092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 526 | Open in IMG/M |
3300032955|Ga0335076_11077135 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300033134|Ga0335073_10128277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3243 | Open in IMG/M |
3300033289|Ga0310914_11120954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300033289|Ga0310914_11662901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 542 | Open in IMG/M |
3300033805|Ga0314864_0106986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacter | 687 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062389_1045386782 | 3300004092 | Bog Forest Soil | GRGTGRALLLVRELAGFTGRGQAPPADLEPLVDAVRAGQFAQAAGRG* |
Ga0066388_1015840722 | 3300005332 | Tropical Forest Soil | RLVRELAGFTARGQAPPGDLEPLVDAVRAGRFARAALPGR* |
Ga0066388_1037098692 | 3300005332 | Tropical Forest Soil | RLVRELAGFTARGQAPPADLEPLVDAVRAGRFARAALPGH* |
Ga0070666_100889975 | 3300005335 | Switchgrass Rhizosphere | GEGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0070682_1009240222 | 3300005337 | Corn Rhizosphere | GTGRALRLVRELADFTARGQAPPADLEPLVDAVRAGSFARAGLPGR* |
Ga0070714_1012273621 | 3300005435 | Agricultural Soil | RFPRLGEGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0070710_105992021 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PRLGEGTGRALRLLRELATFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPA* |
Ga0070706_1019559691 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RFPRLGEGTGRALRLLRELAAFTGHGQAPPADLEPLVDAVRAGRFTDAAGLTP* |
Ga0070698_1014377741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTGRALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFTDAAGA* |
Ga0070699_1014114352 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEGTGRALRLLRELAAFTGPGQAPPADLEPLVDAVRAGRFTDAAAGLTP* |
Ga0070679_1004563822 | 3300005530 | Corn Rhizosphere | PRLGEGTGRALRLLRELAAFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0070672_1002420593 | 3300005543 | Miscanthus Rhizosphere | EGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0070665_1024519052 | 3300005548 | Switchgrass Rhizosphere | RALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG* |
Ga0070702_1010817541 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GRALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPPQRL* |
Ga0066903_1087487991 | 3300005764 | Tropical Forest Soil | GTGRALRLVRELAGFTARGQAPPADLEPLVDAVRAGRLARTALPGQ* |
Ga0097621_1000269826 | 3300006237 | Miscanthus Rhizosphere | RALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFANAAG* |
Ga0074048_133899943 | 3300006581 | Soil | ALRLVRELVDFTARGETPPAELEPLVDAVRAGRFARAAAGR* |
Ga0079222_104357461 | 3300006755 | Agricultural Soil | TGRALRLLRELAAFTGHGQAPPADLEPLVDAVRAGRFTDAAGADAVT* |
Ga0079220_119219041 | 3300006806 | Agricultural Soil | LADFTARGQAPPADLEPLVDAVRAGRFVQAAGLG* |
Ga0075429_1013832161 | 3300006880 | Populus Rhizosphere | EGTGRAVDLVREFADFTARGQAPPAELEPLVDAVRAGRFAGTALPGP* |
Ga0105245_124726092 | 3300009098 | Miscanthus Rhizosphere | LGEGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0105247_113935631 | 3300009101 | Switchgrass Rhizosphere | GTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG* |
Ga0126373_121808741 | 3300010048 | Tropical Forest Soil | GRALGLVRQLAGFTARGQAPPPDMEPLVDAVRAGRFAWTALPGQ* |
Ga0134111_103470612 | 3300010329 | Grasslands Soil | SRLGEGTGRALRLVRELAGFTAHGQAPPAELEPLVDAVRAGRFARAALPGR* |
Ga0126370_100916864 | 3300010358 | Tropical Forest Soil | GEGTGRALGLVRELTDFTARGQAPPAELEPLVDAVRAGRFARTALPGE* |
Ga0126376_116091812 | 3300010359 | Tropical Forest Soil | ALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFADAAGLTP* |
Ga0126378_100177788 | 3300010361 | Tropical Forest Soil | LRLVRELAGFTARGQAPPADLEPLVEAVRAGRFARAAGLGS* |
Ga0126377_108465071 | 3300010362 | Tropical Forest Soil | LREIATFTGHGQAPPADLEPLVDAVRAGRFTDAAGPTP* |
Ga0134128_100643651 | 3300010373 | Terrestrial Soil | RALRLVRERAGFTARGQAPPAELEPLVDAVRAGRFAWAALPGE* |
Ga0126381_1020892561 | 3300010376 | Tropical Forest Soil | EGTGRALRLVRELVGFTARGQAPPAELEPLVDAVRAGSFARTALPGE* |
Ga0126381_1042670072 | 3300010376 | Tropical Forest Soil | RELAGFTARGQAPPPEIEPLVDAVRAGRFARTARPGQ* |
Ga0126383_101849822 | 3300010398 | Tropical Forest Soil | AGFTARGQAPPADLEPLVDAVRAGRFARTALPGQ* |
Ga0134127_113581422 | 3300010399 | Terrestrial Soil | LLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0124850_11516891 | 3300010863 | Tropical Forest Soil | TGRALRLVRELADFTGHGQAPPADLEPLVDAVRAGRFARAALPDQ* |
Ga0137393_103282012 | 3300011271 | Vadose Zone Soil | ALRLLRELAAFTGDGQAPPSDLEPLVDAVRAGRFTDAAGLTP* |
Ga0137365_112734741 | 3300012201 | Vadose Zone Soil | LGEGTGRALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFTDAAGLTP* |
Ga0137399_103605522 | 3300012203 | Vadose Zone Soil | AAFTGHGQAPPADLELLVDAVRAGRFTDAAGLTP* |
Ga0137380_103019151 | 3300012206 | Vadose Zone Soil | RFPRLGEGTGRALRLLRELAAFTGHGQAPPSDLEPLVDAVRAGRFTDAAGLTP* |
Ga0137371_103135411 | 3300012356 | Vadose Zone Soil | LLRELAAFTGQGQAPPSDLELLVDAVRAGRFTDAAGLTP* |
Ga0137385_110876241 | 3300012359 | Vadose Zone Soil | TGRALRLLRELATFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPT* |
Ga0157340_10025912 | 3300012473 | Arabidopsis Rhizosphere | LRLLRELASFTGHGQAPPADLELLVDAVRAGRFTDAAGLTP* |
Ga0157338_10030503 | 3300012515 | Arabidopsis Rhizosphere | GEGTGRALHLVRELAAFTGHGQAPPADLEPLVDAVRAGRFTDAAG* |
Ga0126375_106151591 | 3300012948 | Tropical Forest Soil | CALRLVRELADFTGRGEAPPEELEPLVDAVRAGRFARAAMPGQ* |
Ga0164299_100296405 | 3300012958 | Soil | LLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG* |
Ga0164299_108061482 | 3300012958 | Soil | GTGRALRLLRELATFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPA* |
Ga0132256_1008212512 | 3300015372 | Arabidopsis Rhizosphere | LVRELADFTARGQAPPADLEPLVDAVRAGSFARTALPGQ* |
Ga0182041_104866491 | 3300016294 | Soil | TGRALGLVRELADFTARGQAPPAELEPLVDAVRAGRFARAALPGE |
Ga0182032_116899382 | 3300016357 | Soil | GRPLRLVRELTGFTARGQAPPADLEPLVDAVRAGRFAQAAAQ |
Ga0182040_103354722 | 3300016387 | Soil | VRELTDFTARGQAPPADLEPLVDAVRAGRFARAALPGE |
Ga0187777_102016341 | 3300017974 | Tropical Peatland | TGRALGLVRELVGFAAPGQAPPAELEPLVDAVRAGRFARECR |
Ga0187777_108552101 | 3300017974 | Tropical Peatland | GRALGLVRELAGFTARGQAPPADLEPLVDAVRAGRFARAALPGP |
Ga0187767_103857512 | 3300017999 | Tropical Peatland | AFRLVRELAGFTARGQAPPADLEPLVDAVRAGRFARTALSGQ |
Ga0187766_106995631 | 3300018058 | Tropical Peatland | RLVRELAGFTARGQAPPADLEPLVEAVRAGRFARAGLPGQ |
Ga0193692_11030692 | 3300020000 | Soil | EGTGRALRLLRELASFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPPQRL |
Ga0206356_115669092 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFTDAAG |
Ga0210401_101596351 | 3300020583 | Soil | LRLVRELAGFTARGQVPPPDIEPLVDAVRAGGFARACGTADDQG |
Ga0210408_110005661 | 3300021178 | Soil | RPSRLGDGTGRALHLVRELADFTARGQAPPADLEPLVDAVRAGQFAQAAGRG |
Ga0210394_104904162 | 3300021420 | Soil | PRLGEGTGRALRLLRQLAAFTGHGQAPPADLEPLVDAVRAGRFTDAAGLTP |
Ga0210394_115108632 | 3300021420 | Soil | RALGLVRELAGFTARGQAPPAELEPLVDAVRAGRFARTALPGG |
Ga0210410_102243281 | 3300021479 | Soil | GEGTGRALRLLRELAAFTGHGQAPPADLEPLVDAVRAGRFTDAAGLTP |
Ga0210410_115284251 | 3300021479 | Soil | GRAHRLLRELAAFTGHGQAPPSDLEPLVDAVRAGRFTDAAGLTP |
Ga0126371_124470351 | 3300021560 | Tropical Forest Soil | VRELAGFTARGQAPPAELEPLVDAVRAGRFALTALPGR |
Ga0247670_10202461 | 3300024283 | Soil | RLGEGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG |
Ga0207713_10830732 | 3300025735 | Switchgrass Rhizosphere | EGTGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG |
Ga0207699_102551633 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RALRMLRELATFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPA |
Ga0207663_102840202 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEGTERARRLVRELAGFTAQGQAPPAELEPLVDAVREGRFARTALPG |
Ga0207663_113543421 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG |
Ga0207687_111878022 | 3300025927 | Miscanthus Rhizosphere | RLLRELASFTGHGQAPPADLELLVDAVRAGRFTDAAGLTP |
Ga0207678_119413362 | 3300026067 | Corn Rhizosphere | LADFTARGQAPPADLEPLVDAVRAGSFARAALPGQ |
Ga0208637_10347742 | 3300027401 | Soil | RALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFTDAAEPTPT |
Ga0209179_10588502 | 3300027512 | Vadose Zone Soil | GEGTGRALRLLRELAAFTGHGQAPPADLELLVDAVRAGRFTDAAGLTP |
Ga0268266_103070773 | 3300028379 | Switchgrass Rhizosphere | GEGTSRALRLLRELATFTGHGQAPPADLEPLVDAVRAGRFADAAG |
Ga0307312_102185183 | 3300028828 | Soil | ELASFTGHGQAPPADLELLVDAVRAGRFTDAAGLTPPQRL |
Ga0170824_1008284961 | 3300031231 | Forest Soil | DSRTRDLAGFTARGESPPAELEPLVDAVRAGRFARAAGPGA |
Ga0170819_178470012 | 3300031469 | Forest Soil | EGTGRAFRLVRDLAGFTARGESPPAELEPLVDAVRAGRFARAAGPGA |
Ga0318516_106496592 | 3300031543 | Soil | QALRLVRELAGFTARGQIPPADLEPLVDAVRAGRFARAASSG |
Ga0318541_106144841 | 3300031545 | Soil | GRAHHLVRELAGFTARGQAPPAELEPLVDAVRAGRFARTALPGA |
Ga0318493_102636951 | 3300031723 | Soil | TGRALGLVRELVGFTARGQAPPADIEPLVDAVRMGRFARTALPGQ |
Ga0318493_102779092 | 3300031723 | Soil | GLVRELAGFTDRGQAPPPDIEPLVDAVRAGRFARTALPGQ |
Ga0318500_100726363 | 3300031724 | Soil | RELTGFTARGQAPPADLEPLVDAVRAGRFAQAAAQ |
Ga0318526_100713023 | 3300031769 | Soil | LAAFTGHGQAPPADLEPLVDAVRAGRFAEAAGLAP |
Ga0318547_101794542 | 3300031781 | Soil | TGRALDLVRELAGFTARGQAPPADLEPLVDAVRAGRFARAALPGR |
Ga0318548_101960062 | 3300031793 | Soil | EGTGQALRLVRELADFTARGQVPPADLEPLVDAVRAGRFARAASPG |
Ga0318550_102781443 | 3300031797 | Soil | PRLGEGTGQALRLVRELADFTARGQVPPADLEPLVDAVRAGRFARAASPG |
Ga0318523_100158321 | 3300031798 | Soil | PRALHLVRELVGFTARGQAPPAELEPLVDAVRAKRPARTAVPGE |
Ga0318523_102263442 | 3300031798 | Soil | ALVLVRELAGFTARGQAPPADLEPLVDAVRAGRFAQAAGRD |
Ga0318497_104334791 | 3300031805 | Soil | ARLGEGTGRALHLVRELAGFTARGQAPPADLEPLVDAVRAGQFARAAGLG |
Ga0318568_104400842 | 3300031819 | Soil | LVGFTARGQAPPADIEPLVDAVRMGRFARTALPGQ |
Ga0318564_103273881 | 3300031831 | Soil | RELADFTARGQAPPAELEPLVDAVRAGRFARAALPGE |
Ga0310917_100353043 | 3300031833 | Soil | HLVRELVGFTARGQAPPAELEPLVDAVRAGRFARTAVPGE |
Ga0318511_101587422 | 3300031845 | Soil | DLVRELAGFTARGQAPPADLEPLVDAVRAGRFARAALPGR |
Ga0318536_101436162 | 3300031893 | Soil | EGTGRAHHLVRELAGFTARGQAPPAELEPLVDAVRAGRFARTALPGA |
Ga0310913_106336521 | 3300031945 | Soil | ALGLVRELADFTARGQAPPAELEPLVDAVRAGRFARAALPGE |
Ga0318531_100290191 | 3300031981 | Soil | TGRALGLVRELTDFTARGQAPPADLEPLVDAVRAGRFARAALPGE |
Ga0307470_101483923 | 3300032174 | Hardwood Forest Soil | RFPCLGEGTGRALRLLRELAAFTGHGQAPPADLEALVDAVRAGRFTDAAGLTP |
Ga0307470_114387532 | 3300032174 | Hardwood Forest Soil | LGEGTGRALGLVRELAGFTARGQAPPAELEPLVDAVRAGRFAWAALPGE |
Ga0335080_122240921 | 3300032828 | Soil | TGRAFRLARELAGFTARGQAPPADLEPLVDAVRAGRFARAALSGQ |
Ga0335076_110771351 | 3300032955 | Soil | ARRLVRELAGFTAQGQAPPAELEPLVDAVREGRFARTALPG |
Ga0335073_101282771 | 3300033134 | Soil | LRLVRELAGFTARGQAPPADLEPLVEAVRAGRFAASSGGCR |
Ga0310914_111209541 | 3300033289 | Soil | GTGRALGLVRELTDFTARGQAPPAELEPLVDAVRAGRFARTALPGE |
Ga0310914_116629012 | 3300033289 | Soil | LVRELAGFTARGQAPPPDIEPLVDAVRAGRFARAALSGQ |
Ga0314864_0106986_568_684 | 3300033805 | Peatland | VRELAGFTARGQAPPADLEPLVDAVRAGRFARTALSGQ |
⦗Top⦘ |