NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101552

Metagenome Family F101552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101552
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 41 residues
Representative Sequence VNATSADYGQTTFAQRLRGVFDTLAHLPARTRWSRMLHTVH
Number of Associated Samples 95
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.16 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.647 % of family members)
Environment Ontology (ENVO) Unclassified
(31.373 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.784 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.68%    β-sheet: 0.00%    Coil/Unstructured: 62.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF05170AsmA 78.43
PF13502AsmA_2 1.96
PF12344UvrB 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 78.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100746865All Organisms → cellular organisms → Bacteria → Acidobacteria1417Open in IMG/M
3300002245|JGIcombinedJ26739_100695700All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300002908|JGI25382J43887_10233015All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300004091|Ga0062387_101575543All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300005180|Ga0066685_10580175All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300005332|Ga0066388_100873850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1481Open in IMG/M
3300005332|Ga0066388_108848014All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300005921|Ga0070766_10736953All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300006176|Ga0070765_100990094All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300006904|Ga0075424_101396641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300009038|Ga0099829_10081900All Organisms → cellular organisms → Bacteria → Acidobacteria2473Open in IMG/M
3300009088|Ga0099830_10804774All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300009089|Ga0099828_10493752All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300009522|Ga0116218_1237344All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300009545|Ga0105237_11698747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300009824|Ga0116219_10758471All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010048|Ga0126373_10195992All Organisms → cellular organisms → Bacteria → Acidobacteria1954Open in IMG/M
3300010320|Ga0134109_10046151All Organisms → cellular organisms → Bacteria → Acidobacteria1430Open in IMG/M
3300010339|Ga0074046_10120970All Organisms → cellular organisms → Bacteria → Acidobacteria1681Open in IMG/M
3300010360|Ga0126372_11268704All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300010361|Ga0126378_12432621All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300010362|Ga0126377_12864037All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300010366|Ga0126379_10216384All Organisms → cellular organisms → Bacteria → Acidobacteria1857Open in IMG/M
3300011120|Ga0150983_10062753All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012200|Ga0137382_10096469All Organisms → cellular organisms → Bacteria → Acidobacteria1944Open in IMG/M
3300012202|Ga0137363_10642515All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300012203|Ga0137399_10084771All Organisms → cellular organisms → Bacteria → Acidobacteria2414Open in IMG/M
3300012203|Ga0137399_10520186All Organisms → cellular organisms → Bacteria → Acidobacteria999Open in IMG/M
3300012203|Ga0137399_11460616All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300012208|Ga0137376_11113744All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300012361|Ga0137360_10020836All Organisms → cellular organisms → Bacteria4379Open in IMG/M
3300012582|Ga0137358_10538506All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300012918|Ga0137396_11078877All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012923|Ga0137359_10303724All Organisms → cellular organisms → Bacteria → Acidobacteria1421Open in IMG/M
3300012925|Ga0137419_11119065All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300012927|Ga0137416_10178066All Organisms → cellular organisms → Bacteria → Acidobacteria1689Open in IMG/M
3300012989|Ga0164305_11723784All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300013832|Ga0120132_1067155All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300014157|Ga0134078_10215299All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300014969|Ga0157376_11174886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300015053|Ga0137405_1424806All Organisms → cellular organisms → Bacteria → Acidobacteria2513Open in IMG/M
3300015168|Ga0167631_1034440All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300016319|Ga0182033_10350202All Organisms → cellular organisms → Bacteria → Acidobacteria1235Open in IMG/M
3300017943|Ga0187819_10259991All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300017943|Ga0187819_10784165All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300017948|Ga0187847_10707463All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300017961|Ga0187778_10306092All Organisms → cellular organisms → Bacteria → Acidobacteria1029Open in IMG/M
3300017961|Ga0187778_10894599All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300018033|Ga0187867_10268368All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300020140|Ga0179590_1097256All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300020579|Ga0210407_10342388All Organisms → cellular organisms → Bacteria → Acidobacteria1169Open in IMG/M
3300020580|Ga0210403_10628248All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300020581|Ga0210399_10938021All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300021168|Ga0210406_10470038All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300021171|Ga0210405_10674862All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300021178|Ga0210408_11248576All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300021181|Ga0210388_11367164All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300021404|Ga0210389_10458979All Organisms → cellular organisms → Bacteria → Acidobacteria1002Open in IMG/M
3300021420|Ga0210394_11486245All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300021475|Ga0210392_10037467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2902Open in IMG/M
3300021478|Ga0210402_10419108All Organisms → cellular organisms → Bacteria → Acidobacteria1243Open in IMG/M
3300021479|Ga0210410_11276565All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300021559|Ga0210409_10230764All Organisms → cellular organisms → Bacteria → Acidobacteria1679Open in IMG/M
3300021559|Ga0210409_10923172All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300024283|Ga0247670_1074270All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300025448|Ga0208037_1017967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1729Open in IMG/M
3300025910|Ga0207684_11620481All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300025961|Ga0207712_12065197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300026214|Ga0209838_1016084All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300026285|Ga0209438_1193749All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300026308|Ga0209265_1036850All Organisms → cellular organisms → Bacteria → Acidobacteria1513Open in IMG/M
3300026318|Ga0209471_1254091All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300026330|Ga0209473_1166162All Organisms → cellular organisms → Bacteria → Acidobacteria878Open in IMG/M
3300026515|Ga0257158_1005226All Organisms → cellular organisms → Bacteria → Acidobacteria1804Open in IMG/M
3300026869|Ga0207821_1013004All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300026879|Ga0207763_1009710All Organisms → cellular organisms → Bacteria → Acidobacteria1016Open in IMG/M
3300027024|Ga0207819_1012632All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300027535|Ga0209734_1007010All Organisms → cellular organisms → Bacteria → Acidobacteria2012Open in IMG/M
3300027616|Ga0209106_1044742All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300027651|Ga0209217_1111683All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300027660|Ga0209736_1024188All Organisms → cellular organisms → Bacteria → Acidobacteria1843Open in IMG/M
3300027660|Ga0209736_1183500All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300027775|Ga0209177_10050842All Organisms → cellular organisms → Bacteria → Acidobacteria1174Open in IMG/M
3300027846|Ga0209180_10245128All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300027854|Ga0209517_10553805All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300027867|Ga0209167_10192954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300027889|Ga0209380_10208751All Organisms → cellular organisms → Bacteria → Acidobacteria1147Open in IMG/M
3300027911|Ga0209698_11228391All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300028906|Ga0308309_10966794All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300029993|Ga0302304_10344419All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300031231|Ga0170824_116844872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300031474|Ga0170818_106261548All Organisms → cellular organisms → Bacteria → Acidobacteria945Open in IMG/M
3300031715|Ga0307476_10649745All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300031718|Ga0307474_10927402All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300031823|Ga0307478_10696653All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300031941|Ga0310912_10277660All Organisms → cellular organisms → Bacteria → Acidobacteria1294Open in IMG/M
3300031946|Ga0310910_10376120All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300031954|Ga0306926_12604732All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300032001|Ga0306922_10025334All Organisms → cellular organisms → Bacteria → Acidobacteria5973Open in IMG/M
3300032174|Ga0307470_10468815All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300032261|Ga0306920_100828421All Organisms → cellular organisms → Bacteria → Acidobacteria1357Open in IMG/M
3300032897|Ga0335071_10094459All Organisms → cellular organisms → Bacteria → Acidobacteria2932Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026869Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes)EnvironmentalOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10074686513300000955SoilATSGDYIGDTTFWSRLTAIFQTLAHLPSRTRWSRMLRTVH*
JGIcombinedJ26739_10069570023300002245Forest SoilYGQTSFFQRLKSVVDTLLHLPQRTRWSRMLRTVH*
JGI25382J43887_1023301523300002908Grasslands SoilPFLVYWSVDATSGDYSGETTFWSRLTGIFQTLAHLPSRTRWSRMLRTVH*
Ga0062387_10157554313300004091Bog Forest SoilYWSVDATTADYAKETTFFSRLTSVFDNIRHLPARTRWGRMLHTVH*
Ga0066685_1058017523300005180SoilPFLIYWSVEAKSGDYSGESTFWSRLAGVVQTLAHLPSRTRWSRMLHTVH*
Ga0066388_10087385013300005332Tropical Forest SoilWSVQATSVDYGESTFAQRLRAVLQTVAHLPARTRWSRMLHTVH*
Ga0066388_10884801413300005332Tropical Forest SoilSVEATTDDYAQSTFLQRVAGVLDTLMHLPARTRWSRMLHTVH*
Ga0070766_1073695313300005921SoilSSADYSASTFFQRLAGIFDTLLHLPTRTRWSRMLHTVH*
Ga0070765_10099009423300006176SoilIYWSVDATSNDYTQTTFIQRLIGVFDTLVHLPARTRWSRMLHTVR*
Ga0075424_10139664123300006904Populus RhizosphereADYGESTFMQRLRGVLVTIAHLPARTRWSRMLHTVH*
Ga0099829_1008190013300009038Vadose Zone SoilSVEASSADYGQSTFLQRLKSVVDTLLHLPQRTRWSRMLRTVH*
Ga0099830_1080477423300009088Vadose Zone SoilSVNATSADYSSESTFWTRLSGVIDTLIHLPARTRWSRMLHTVH*
Ga0099828_1049375213300009089Vadose Zone SoilSADYGQSSFLQRLKSVVDTLLHLPQRTRWSRMLRTVH*
Ga0116218_123734423300009522Peatlands SoilYNETSFGQRIIGVLDTLLHLPARTRWSRMLRTVH*
Ga0105237_1169874723300009545Corn RhizosphereSVEATSADYGESTFAQRLRAVLQTVAHLPARTRWARMLRTVH*
Ga0116219_1075847123300009824Peatlands SoilYSDTSFGQRIIGILDTLLHLPARTRWSRMLHTVH*
Ga0126373_1019599213300010048Tropical Forest SoilSSADYGSTTFGERIFGIFDTLSHLPARTRWNRMLHTVH*
Ga0134109_1004615123300010320Grasslands SoilSDYTGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH*
Ga0074046_1012097013300010339Bog Forest SoilSSDYSETSFGQRIIGILDTLVHLPARTRWSRMLHTVH*
Ga0126372_1126870413300010360Tropical Forest SoilRPLFIYWSIDATSSDYSADTSFLKRLLAVLDTIVHLPKRTRWSRMLRTVH*
Ga0126378_1243262123300010361Tropical Forest SoilLIYWSVEAKSSDYSGESTFWSRLAGVFDTLAHLPTRTRWSRMIHTVH*
Ga0126377_1286403723300010362Tropical Forest SoilFLIYWSVEATADDYAQNSTFFQRLAGIADTLAHLPARTRWNRMLRTVH*
Ga0126379_1021638423300010366Tropical Forest SoilYSDSTFGQRIIGIFDALMHLPARTRWSRMLHTVH*
Ga0150983_1006275323300011120Forest SoilLIYWSVDAKSSDYNTETTFWSRLVGVFETLAHLPTRTRWSRMLHTVH*
Ga0137382_1009646923300012200Vadose Zone SoilFLIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH*
Ga0137363_1064251513300012202Vadose Zone SoilRPFLIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH*
Ga0137399_1008477123300012203Vadose Zone SoilVDAKSADYSGESTFWSRLSGVFETLVHLPSRTRWSRMLHTVH*
Ga0137399_1052018623300012203Vadose Zone SoilWSVDATSGDYSGDSTFWSRLTGILQTLAHLPSRTRWSRMLRTVH*
Ga0137399_1146061623300012203Vadose Zone SoilIYWSVDANSADYTGESTYWSRLVGVFETLVHLPSRTRWSRMLHTVH*
Ga0137376_1111374423300012208Vadose Zone SoilLIYWSVEAKSSDYSGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH*
Ga0137360_1002083633300012361Vadose Zone SoilADYGQSSFLQRLKSVIDTLLHLPQRTRWSRMLRTVH*
Ga0137358_1053850623300012582Vadose Zone SoilATSGDYSGETTFWSRLTGIFQTLAHLPSRTRWSRMLRTVH*
Ga0137396_1107887723300012918Vadose Zone SoilYWSVDANSNDYSESSFGQRILAIFDTITHLPARTRWNRMLHTVH*
Ga0137359_1030372423300012923Vadose Zone SoilYWSVEASSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH*
Ga0137419_1111906513300012925Vadose Zone SoilIYWSVDAKSADYSGESTFWSRLSGIFETMVHLPSRTRWSRMLHTVH*
Ga0137416_1017806623300012927Vadose Zone SoilRPFLIYWSVEAKSSDYGGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH*
Ga0164305_1172378413300012989SoilVEASSSDYSPSTFFQRLAGIFETIAHLPSRTRWSRMLHTVH*
Ga0120132_106715523300013832PermafrostIYWSVDATSADYAGDSSFLQRLAGIFDTIVPLPARTRWHRMFHTVH*
Ga0134078_1021529923300014157Grasslands SoilLIYWSVEAKSSDYTGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH*
Ga0157376_1117488623300014969Miscanthus RhizosphereYGESTFGQRLRAVLQTVAHLPARTRWSRMLHTVH*
Ga0137405_142480613300015053Vadose Zone SoilHGRPVFIYWSIDASSADYAGDATFLKRLGGVLDTIIHLPQRTRWSRMLHTVH*
Ga0167631_103444023300015168Glacier Forefield SoilDATSADYTGDSTFLRRLGGILDTLVHLPARTRWKRMLHTVH*
Ga0182033_1035020213300016319SoilSSDYADSTFSQRVVAVFDTLLHLPARTRWSRMLHTVH
Ga0187819_1025999123300017943Freshwater SedimentSVDARSDDYAGDTTFFQRLRGVFETLGHLPSRTRWARMLHTVH
Ga0187819_1078416523300017943Freshwater SedimentLIYWSIDASSADYTDNTFGQRIIGIFDTLLHLPARTRWGRMLHTVH
Ga0187847_1070746313300017948PeatlandSADYAKETTFWSRLSSVFDNVAHLPARTRWSRMLHTVR
Ga0187778_1030609213300017961Tropical PeatlandIDANSNDYSDSTFGQRLVGIFDALMHLPARTRWSRMLHTVR
Ga0187778_1089459923300017961Tropical PeatlandDYSDSSFAQRIVGIFDTLMHLPARTRWSRMLHTVH
Ga0187867_1026836813300018033PeatlandSSDYSDTSFMQRIAGVFDTLLHLPARTRWSRMLHTVH
Ga0179590_109725623300020140Vadose Zone SoilSVDANSNDYSESSFGQRILAIFDTITHLPARTRWNRMLHTVH
Ga0210407_1034238813300020579SoilSVEATSSDYTGDSSFWSRLTGVFDTLMHLPSRTRWSRMLHTVH
Ga0210403_1062824823300020580SoilNDYSDSSFGQRILAIFDTITHLPARTRWSRMLHTVH
Ga0210399_1093802123300020581SoilNSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH
Ga0210406_1047003813300021168SoilDYNTETTFWSRLVGVFETLAHLPTRTRWSRMLHTVH
Ga0210405_1067486213300021171SoilWSVEASSADYNPSTFWQRLAGVFDTLLHLPSRTRWSRMLHTVH
Ga0210408_1124857623300021178SoilDYNRSTFFQRLAGIFETLAHLPTRTRWSRMLHTVH
Ga0210388_1136716423300021181SoilVDATSNDYSDSSFTQRILAIFDTLTHLPARTRWNRMLHTVH
Ga0210389_1045897913300021404SoilASSADYGQSSFFQRLKSVIDTLLHLPQRTRWGRMLRTVH
Ga0210394_1148624513300021420SoilATSNDYTQTTFIQRLIGVFDTIAHLPARTRWSRMLHTVH
Ga0210392_1003746733300021475SoilATSNDYSDSSFGQRILAIFDTITHLPARTRWSRMLHTVH
Ga0210402_1041910823300021478SoilDATSNDYTQTTFIQRLIGVFDTIAHLPARTRWSRMLHTVH
Ga0210410_1127656513300021479SoilTSNDYTQSTFLQRLVAVFDTLTHLPARTRWSRMLHTVH
Ga0210409_1023076423300021559SoilWSVDATSNDYSDSSFGERILAIFDTITHLPARTRWSRMLHTVH
Ga0210409_1092317213300021559SoilSVDATSSDYNNESTFWTRLTGIFQTLAHLPSRTRWSRMLRTVH
Ga0247670_107427023300024283SoilNDYSDSSFGRRILAIFDTLTHLPARTRWNRMLHTVH
Ga0208037_101796723300025448PeatlandIEADSSDYSADTSLWSRLTGMADTLVHLPTRTRWSRMFHLVH
Ga0207684_1162048113300025910Corn, Switchgrass And Miscanthus RhizosphereNSADYGQSSFPQRLKSVVDTLLHLPQRTRWSRMLRTVH
Ga0207712_1206519713300025961Switchgrass RhizosphereATSADYGESTFAQRLRAVLQTVAHLPARTRWARMLRTVH
Ga0209838_101608413300026214SoilADYTNDSTFWRRLGGIFDTLAHLPKRTRWKRMLHTVH
Ga0209438_119374923300026285Grasslands SoilSADYGQSSFLQRLKSVVDTLLHLPQRTRWSRMLRTVH
Ga0209265_103685013300026308SoilLIYWSVEAKSSDYSGESTFWSRLAGVFDTLAHLPKRTRWSRMLHTVH
Ga0209471_125409123300026318SoilDAQSADYSRESTYWSRLVGVLETLVHLPSRTRWSRMLHTVH
Ga0209473_116616223300026330SoilFLIYWSVEAKSNDYTGESTFWSRLVGVFDTLAHLPSRTRWSRMLHTVH
Ga0257158_100522613300026515SoilYWSVDAKSADYSGESTFWSRLSGVFETLVHLPSRTRWGRMLHTVH
Ga0207821_101300423300026869Tropical Forest SoilSDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH
Ga0207763_100971023300026879Tropical Forest SoilVEASSSDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH
Ga0207819_101263223300027024Tropical Forest SoilSSSDYGEASFGQRIVGIFDTLLHLPARTRWSRMLHTVH
Ga0209734_100701013300027535Forest SoilFLIYWSVEATGTDYGPSTFWQRLVSVFQTLAHLPQRTRWGRMLRTVH
Ga0209106_104474213300027616Forest SoilSSDYGGDTTFWSRLTGILQTLVHLPSRTRWGRMLHTVH
Ga0209217_111168323300027651Forest SoilSIEASSADYGQSSFRERLSGVIDTLAHLPARTRWGRMLHSVH
Ga0209736_102418823300027660Forest SoilWSVDANSNDYSNTSFGQRVLGIFDTLTHLPARTRWSRMLHTVH
Ga0209736_118350013300027660Forest SoilKSSDYGGDTTFWSRLTGILQTLVHLPSRTRWSRMLHTVH
Ga0209177_1005084213300027775Agricultural SoilWSVEAKSSDYSGESTFWSRLAGVFDTLAHLPTRTRWSRMLHTVH
Ga0209180_1024512823300027846Vadose Zone SoilSVEASSADYGQSTFLQRLKSVVDTLLHLPQRTRWSRMLRTVH
Ga0209517_1055380513300027854Peatlands SoilSSDYNETSFGQRIIGILDTLLHLPARTRWSRMLRTVH
Ga0209167_1019295413300027867Surface SoilVNATSADYGQSTFGERLRAVLDTIAHLPARTRWSRMLRTVH
Ga0209380_1020875113300027889SoilSSADYSASTFFQRLAGIFDTLLHLPTRTRWSRMLHTVH
Ga0209698_1122839123300027911WatershedsLIYWSVEATSGDYSSETSFGTRLWGVIDTLMHLPARTRWSRMLHTVH
Ga0308309_1096679413300028906SoilEANSSDYAESTFGQRIVGVFDTLLHLPARTRWSRMLHTVH
Ga0302304_1034441923300029993PalsaSSADYAQTTFGQRLRGIFETIAHLPSRTRWSRMLRTVH
Ga0170824_11684487223300031231Forest SoilVNATSADYGQTTFAQRLRGVFDTLAHLPARTRWSRMLHTVH
Ga0170818_10626154833300031474Forest SoilEATSADYAGDSSFFQRLAGIFDTIVHLPARTRWHRMFHTVH
Ga0307476_1064974513300031715Hardwood Forest SoilSVEANSADYGQTSFFQRLKSVVDTLLHLPQRTRWSRMLRTVH
Ga0307474_1092740213300031718Hardwood Forest SoilTSSDYAGDSTFWQRLVGIFDTLMHLPARTRWHRMFHTVH
Ga0307478_1069665313300031823Hardwood Forest SoilEASSADYGQASFFQRLKSVIDTLLHLPQRTRWSRMLHTVH
Ga0310912_1027766023300031941SoilNSNDYGDSSFSQRLVGIFDTLRHLPARTRWSRMLHTVH
Ga0310910_1037612023300031946SoilSIEASSSDYGEASFGQRIVGIFDTLLHLPRRTRWSRMLHTVH
Ga0306926_1260473223300031954SoilSSDYGEASFGQRIVGIFDTLLHLPGRTRWSRMLHTVH
Ga0306922_1002533413300032001SoilADYSDSTFGQRIIGIFDTLMHLPARTRWSRMLHTVH
Ga0307470_1046881523300032174Hardwood Forest SoilATSNDYSDSSFTQRILGVFDTITHLPARTRWSRMLHTVH
Ga0306920_10082842123300032261SoilDASTSDYADSTFFQRVVAIFDTLLHLPARTRWSRMLHTVH
Ga0335071_1009445913300032897SoilVEANSSDYADSNFAQRIVGVFDTLAHLPSRTRWSRMLHTVH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.