Metagenome / Metatranscriptome Family F101565

Basic Information
Family ID	F101565
Family Type	Metagenome / Metatranscriptome
Number of Sequences	102
Average Sequence Length	38 residues
Representative Sequence	GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Number of Associated Samples	85
Number of Associated Scaffolds	102

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	4.90 %
% of genes near scaffold ends (potentially truncated)	94.12 %
% of genes from short scaffolds (< 2000 bps)	83.33 %
Associated GOLD sequencing projects	83
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Most Common Taxonomy
Group	Bacteria (71.569 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.569 % of family members)
Environment Ontology (ENVO)	Unclassified (22.549 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.059 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 102 Family Scaffolds
PF01568	Molydop_binding	20.59
PF09084	NMT1	7.84
PF03819	MazG	4.90
PF03401	TctC	2.94
PF03749	SfsA	2.94
PF04955	HupE_UreJ	2.94
PF01471	PG_binding_1	1.96
PF09351	DUF1993	1.96
PF00072	Response_reg	0.98
PF00120	Gln-synt_C	0.98
PF00994	MoCF_biosynth	0.98
PF04392	ABC_sub_bind	0.98
PF13379	NMT1_2	0.98
PF00107	ADH_zinc_N	0.98
PF07859	Abhydrolase_3	0.98
PF13545	HTH_Crp_2	0.98
PF00596	Aldolase_II	0.98
PF03459	TOBE	0.98
PF13620	CarboxypepD_reg	0.98
PF01494	FAD_binding_3	0.98
PF01566	Nramp	0.98
PF12706	Lactamase_B_2	0.98
PF00144	Beta-lactamase	0.98
PF11941	DUF3459	0.98
PF07995	GSDH	0.98
PF04909	Amidohydro_2	0.98
PF13450	NAD_binding_8	0.98
PF01503	PRA-PH	0.98
PF00753	Lactamase_B	0.98
PF03972	MmgE_PrpD	0.98
PF08241	Methyltransf_11	0.98
PF07883	Cupin_2	0.98
PF03330	DPBB_1	0.98
PF01425	Amidase	0.98
PF03466	LysR_substrate	0.98
PF13407	Peripla_BP_4	0.98

COG ID	Name	Functional Category	% Frequency in 102 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	7.84
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	7.84
COG1489	DNA-binding protein, stimulates sugar fermentation	Signal transduction mechanisms [T]	2.94
COG2370	Hydrogenase/urease accessory protein HupE	Posttranslational modification, protein turnover, chaperones [O]	2.94
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.94
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.96
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.98
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.98
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.98
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.98
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.98
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.98
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.98
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.98
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.98
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.98
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.98
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.98

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.57 %
Unclassified	root	N/A	28.43 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.57 %
Unclassified	root	N/A	28.43 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.57 %
Unclassified	root	N/A	28.43 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	51.96 %
Unclassified	root	N/A	28.43 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	32.35 %
Unclassified	root	N/A	28.43 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	3.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.43 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20.59 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3.92 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	2.94 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.43 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	6.86 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4.90 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	3.92 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.96 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.98 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	0.98 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.43 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	6.86 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.90 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.94 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.96 %
Deltaproteobacteria bacterium GWA2_57_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13	0.98 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.98 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.98 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.43 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	6.86 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.94 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.96 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.98 %
Deltaproteobacteria bacterium GWA2_57_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13	0.98 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.98 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.43 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5.88 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2.94 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.96 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.96 %
Rhodoplanes sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	0.98 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.98 %
Deltaproteobacteria bacterium GWA2_57_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13	0.98 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.98 %
Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	0.98 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.98 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000890\|JGI11643J12802_10154900	Not Available	925	Open in IMG/M
3300005471\|Ga0070698_100154928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2237	Open in IMG/M
3300005471\|Ga0070698_101680384	Not Available	587	Open in IMG/M
3300005533\|Ga0070734_10807348	Not Available	533	Open in IMG/M
3300005568\|Ga0066703_10327356	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300005764\|Ga0066903_100457453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2137	Open in IMG/M
3300005764\|Ga0066903_101840488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1158	Open in IMG/M
3300005764\|Ga0066903_107721668	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300006057\|Ga0075026_100661741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	620	Open in IMG/M
3300006176\|Ga0070765_100601488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1037	Open in IMG/M
3300006196\|Ga0075422_10551044	Not Available	529	Open in IMG/M
3300006806\|Ga0079220_11824629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300006847\|Ga0075431_101348282	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300006880\|Ga0075429_101791352	Not Available	533	Open in IMG/M
3300006914\|Ga0075436_100097112	Not Available	2050	Open in IMG/M
3300006969\|Ga0075419_10300580	Not Available	1082	Open in IMG/M
3300009143\|Ga0099792_11144101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	526	Open in IMG/M
3300009162\|Ga0075423_10617372	All Organisms → cellular organisms → Bacteria	1143	Open in IMG/M
3300009176\|Ga0105242_12532878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17	561	Open in IMG/M
3300009792\|Ga0126374_10369369	All Organisms → cellular organisms → Bacteria	991	Open in IMG/M
3300010046\|Ga0126384_11760325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	587	Open in IMG/M
3300010360\|Ga0126372_10526874	All Organisms → cellular organisms → Bacteria	1116	Open in IMG/M
3300010361\|Ga0126378_13089379	Not Available	530	Open in IMG/M
3300010366\|Ga0126379_10389418	All Organisms → cellular organisms → Bacteria	1438	Open in IMG/M
3300010376\|Ga0126381_102437731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	750	Open in IMG/M
3300010376\|Ga0126381_103549122	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300010376\|Ga0126381_103853110	Not Available	585	Open in IMG/M
3300010376\|Ga0126381_104247989	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300010391\|Ga0136847_10561410	All Organisms → cellular organisms → Bacteria → Proteobacteria	904	Open in IMG/M
3300010398\|Ga0126383_10145259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2203	Open in IMG/M
3300010398\|Ga0126383_11384425	All Organisms → cellular organisms → Bacteria → Proteobacteria	793	Open in IMG/M
3300010398\|Ga0126383_11713713	Not Available	717	Open in IMG/M
3300010400\|Ga0134122_13082080	All Organisms → cellular organisms → Bacteria → Proteobacteria	521	Open in IMG/M
3300011422\|Ga0137425_1010759	All Organisms → cellular organisms → Bacteria → Proteobacteria	1836	Open in IMG/M
3300012189\|Ga0137388_10013603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5868	Open in IMG/M
3300012201\|Ga0137365_10031808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4049	Open in IMG/M
3300012212\|Ga0150985_117544797	Not Available	591	Open in IMG/M
3300012469\|Ga0150984_121810320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	1626	Open in IMG/M
3300012685\|Ga0137397_10332201	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1133	Open in IMG/M
3300012930\|Ga0137407_10115108	All Organisms → cellular organisms → Bacteria → Proteobacteria	2327	Open in IMG/M
3300012930\|Ga0137407_10439808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1212	Open in IMG/M
3300012930\|Ga0137407_11164875	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	731	Open in IMG/M
3300012955\|Ga0164298_10524878	Not Available	797	Open in IMG/M
3300012957\|Ga0164303_10998449	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300012971\|Ga0126369_11372717	Not Available	797	Open in IMG/M
3300012971\|Ga0126369_13161940	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300012976\|Ga0134076_10638224	All Organisms → cellular organisms → Bacteria → Proteobacteria	501	Open in IMG/M
3300012984\|Ga0164309_11311596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	613	Open in IMG/M
3300012988\|Ga0164306_10560449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	889	Open in IMG/M
3300014497\|Ga0182008_10502031	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300014880\|Ga0180082_1003848	All Organisms → cellular organisms → Bacteria → Proteobacteria	2931	Open in IMG/M
3300015242\|Ga0137412_10299282	All Organisms → cellular organisms → Bacteria	1262	Open in IMG/M
3300016270\|Ga0182036_11719257	Not Available	530	Open in IMG/M
3300016404\|Ga0182037_10340507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1218	Open in IMG/M
3300016404\|Ga0182037_10661932	All Organisms → cellular organisms → Bacteria → Proteobacteria	891	Open in IMG/M
3300016422\|Ga0182039_10431941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1125	Open in IMG/M
3300016422\|Ga0182039_11190445	Not Available	688	Open in IMG/M
3300017792\|Ga0163161_11431710	Not Available	604	Open in IMG/M
3300017792\|Ga0163161_11793224	Not Available	545	Open in IMG/M
3300018433\|Ga0066667_10173968	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1550	Open in IMG/M
3300019889\|Ga0193743_1123412	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13	931	Open in IMG/M
3300021171\|Ga0210405_11327526	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300021178\|Ga0210408_10199882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1589	Open in IMG/M
3300021178\|Ga0210408_10481761	Not Available	987	Open in IMG/M
3300021403\|Ga0210397_10700145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	779	Open in IMG/M
3300021420\|Ga0210394_11855369	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300021444\|Ga0213878_10468825	Not Available	552	Open in IMG/M
3300021475\|Ga0210392_11395183	Not Available	524	Open in IMG/M
3300021476\|Ga0187846_10271587	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300021477\|Ga0210398_10045667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3613	Open in IMG/M
3300025915\|Ga0207693_10014313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	6383	Open in IMG/M
3300025934\|Ga0207686_11454759	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300025937\|Ga0207669_10926046	Not Available	729	Open in IMG/M
3300025961\|Ga0207712_11742720	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300026089\|Ga0207648_10831874	Not Available	860	Open in IMG/M
3300026121\|Ga0207683_11756512	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300026295\|Ga0209234_1273754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	544	Open in IMG/M
3300026538\|Ga0209056_10148175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1803	Open in IMG/M
3300027862\|Ga0209701_10067606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2266	Open in IMG/M
3300027886\|Ga0209486_10112605	All Organisms → cellular organisms → Bacteria	1458	Open in IMG/M
3300027903\|Ga0209488_10004460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10934	Open in IMG/M
3300028047\|Ga0209526_10276810	Not Available	1141	Open in IMG/M
3300028814\|Ga0307302_10264829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	843	Open in IMG/M
3300030904\|Ga0308198_1089656	All Organisms → cellular organisms → Bacteria → Proteobacteria	527	Open in IMG/M
3300031226\|Ga0307497_10012578	All Organisms → cellular organisms → Bacteria → Proteobacteria	2443	Open in IMG/M
3300031564\|Ga0318573_10041642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2204	Open in IMG/M
3300031713\|Ga0318496_10144298	Not Available	1297	Open in IMG/M
3300031724\|Ga0318500_10092815	All Organisms → cellular organisms → Bacteria	1362	Open in IMG/M
3300031724\|Ga0318500_10330296	Not Available	750	Open in IMG/M
3300031744\|Ga0306918_10245423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1365	Open in IMG/M
3300031765\|Ga0318554_10650126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	593	Open in IMG/M
3300031778\|Ga0318498_10230627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	837	Open in IMG/M
3300031779\|Ga0318566_10090851	Not Available	1492	Open in IMG/M
3300031779\|Ga0318566_10303783	Not Available	789	Open in IMG/M
3300031821\|Ga0318567_10051512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2128	Open in IMG/M
3300031835\|Ga0318517_10009961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3371	Open in IMG/M
3300031879\|Ga0306919_10656283	All Organisms → cellular organisms → Bacteria → Proteobacteria	809	Open in IMG/M
3300031942\|Ga0310916_10643742	All Organisms → cellular organisms → Bacteria	899	Open in IMG/M
3300031946\|Ga0310910_10779867	Not Available	753	Open in IMG/M
3300032090\|Ga0318518_10456686	Not Available	654	Open in IMG/M
3300033290\|Ga0318519_10014215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3383	Open in IMG/M
3300034268\|Ga0372943_0113994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1606	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	83.33%
Host-Associated	Host-Associated	16.67%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.41%
Plants	Host-Associated → Plants	16.67%
Aquatic	Environmental → Aquatic	3.92%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.90%
Sediment	Environmental → Aquatic → Sediment	2.94%
Freshwater	Environmental → Aquatic → Freshwater	0.98%
Cave	Environmental → Terrestrial → Cave	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.80%
Loam	Environmental → Terrestrial → Soil → Loam	7.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.94%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.96%
Lake	Environmental → Aquatic → Freshwater → Lake	0.98%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.98%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.98%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.29%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	28.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.80%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.90%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.96%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.98%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.98%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	21.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.73%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.86%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.94%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.94%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.96%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.98%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.98%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.98%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.98%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.98%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.98%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.98%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.98%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.98%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.98%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.98%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300014880	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021444	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental	Open in IMG/M
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300030904	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031835	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F101565

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11643J12802_101549004	3300000890	Soil	KGLNQVIRVMAEAGQLHAPLPAAERFVDLQYLRAAGLMK*
Ga0070698_1001549281	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	LKGLSQVIQFMGETGDLKPPLASAERFVDLQYLRAAGLQ*
Ga0070698_1016803841	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	RAVARCVIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ*
Ga0070734_108073481	3300005533	Surface Soil	DFAGLKQVIAFMAEARLIAPPLPLPERFVDLQYLRAAAIE*
Ga0066703_103273561	3300005568	Soil	CMIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ*
Ga0066903_1004574531	3300005764	Tropical Forest Soil	DLKGFKTAIEFMGEAGVLKAPLPPPERFVDLQYLRAAGVQ*
Ga0066903_1018404882	3300005764	Tropical Forest Soil	TAIEFMGEAEVLKAPLPPPERFVDLQYLRAAGLQ*
Ga0066903_1077216683	3300005764	Tropical Forest Soil	GFKTAIEFMGEAGVLKAPLPPPERFVDLQYLRAAGLQ*
Ga0075026_1006617411	3300006057	Watersheds	EVIALMAEAGMLKAPLPVAERFVDLQYLRAAGLQ*
Ga0070765_1006014881	3300006176	Soil	AVIALLGRTGELKAPLPAAERFVDLQYLKAAGLQ*
Ga0075422_105510441	3300006196	Populus Rhizosphere	EQVIAMMGEGGILAPPLPPADRFVDLQFLQAAGIQ*
Ga0079220_118246291	3300006806	Agricultural Soil	QAIALMGEGGILKGPLPRAERFVDLQYLQAAGVQ*
Ga0075431_1013482821	3300006847	Populus Rhizosphere	PKGLAQVIAFMADAGHLQPPLPDAERFVDLGYLARAGVR*
Ga0075429_1017913522	3300006880	Populus Rhizosphere	PKGVAQVIAFMADAGQIQPPLPHAERFVDLSYLARAGVR*
Ga0075436_1000971121	3300006914	Populus Rhizosphere	GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ*
Ga0075419_103005801	3300006969	Populus Rhizosphere	GFNRVIQIMAEAGEVKPPLPSAERFVDLQYLHAAGLMK*
Ga0099792_111441012	3300009143	Vadose Zone Soil	QVIAMLGEAGALKPPLPKPEQFVDLQYLRAGGLQ*
Ga0075423_106173721	3300009162	Populus Rhizosphere	LKGFRTAIEFLGEASVLKAPLPPVERFVDLQYLRAAGLQ*
Ga0105242_125328781	3300009176	Miscanthus Rhizosphere	VAQVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR*
Ga0126374_103693691	3300009792	Tropical Forest Soil	AGEINIKGMEQVIAMMGEGGVLAPPLPAADRFVDLQFLQAAGIQ*
Ga0126384_117603251	3300010046	Tropical Forest Soil	LRGMEQVIAMMGEGGVLAPPLPPADRFVDLQFLQAAGIQ*
Ga0126372_105268743	3300010360	Tropical Forest Soil	AGEINIKGMEQVIAMMGEGGVLAPPLPAADRFVDLQFLQAAGSQ*
Ga0126378_130893791	3300010361	Tropical Forest Soil	VSAVIALLGRTGELTASLPAAERFVDLQYLEAAGLQ*
Ga0126379_103894181	3300010366	Tropical Forest Soil	LKGLAQAITLMGEAGTLKGPLPPAERFVDLQYLRLAGFQ*
Ga0126381_1024377311	3300010376	Tropical Forest Soil	LKQVITLMSEAGNLKPPLPAAERFVDAQYLKDAGVE*
Ga0126381_1035491221	3300010376	Tropical Forest Soil	ELNLNGLTQVSAFMGEAGTIESPLGAAGRFVDLQYLEAAGVR*
Ga0126381_1038531101	3300010376	Tropical Forest Soil	GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAEVQ*
Ga0126381_1042479892	3300010376	Tropical Forest Soil	GAPARVVAMMAQAGLLKPPLPSAQRFVDLQYLRAAGLQ*
Ga0136847_105614102	3300010391	Freshwater Sediment	GQVIQFMGEAGELKPPLPAPERFVDLQYLQAAGVY*
Ga0126383_101452594	3300010398	Tropical Forest Soil	QVVAMMAETGALSPPLPAPETFVDRQYLQAAGVN*
Ga0126383_113844252	3300010398	Tropical Forest Soil	QAIALMGEAGTLKGPLPPAERFVDLQYLRLAGFQ*
Ga0126383_117137131	3300010398	Tropical Forest Soil	TAIEFMGEAGVLKEPLPPPERFVDLQYLHAAGVQ*
Ga0134122_130820801	3300010400	Terrestrial Soil	SFAQVIAFMVEAGQLKPPLPAAERFVDLQYLEAAGVR*
Ga0137425_10107593	3300011422	Soil	QVIAFMAEAGQLKAPLPLPERFVDLQYLRLAGVR*
Ga0137388_100136034	3300012189	Vadose Zone Soil	LELVIAMMGEGGALKAPLPQAERFVDLQYLRAAGVQ*
Ga0137365_100318083	3300012201	Vadose Zone Soil	MEQVIALMGESETIKAPLPAVERFVDLQYLHAAGVQ*
Ga0150985_1175447971	3300012212	Avena Fatua Rhizosphere	ADLAQVIAFMGDGGMLAQPLPPPERFVDPQYLKAAGAE*
Ga0150984_1218103203	3300012469	Avena Fatua Rhizosphere	LAQVIAMMADAGAIKTPLPSPEQFVDLQYLRTAGVP*
Ga0137397_103322013	3300012685	Vadose Zone Soil	RAVSRCMIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ*
Ga0137407_101151084	3300012930	Vadose Zone Soil	ATAIEFMGEAGVLKAPLPPVERFVDLQYLRAAGLQ*
Ga0137407_104398082	3300012930	Vadose Zone Soil	KALDQVIAMLGEAGALKAPLPSAERFVDLQYLRAAGVQ*
Ga0137407_111648752	3300012930	Vadose Zone Soil	GQVIQFMAEAGELKPPLPQPERFVDLQYLQAAGLQ*
Ga0164298_105248782	3300012955	Soil	GMEQAIALMGEGGILKAPLPRAERFVDLQYLQAAGVQ*
Ga0164303_109984491	3300012957	Soil	MTKVIELLGQTGELKGPLPAAERFVDLQYLEAAGMR*
Ga0126369_113727171	3300012971	Tropical Forest Soil	GEINLRGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAEVQ*
Ga0126369_131619401	3300012971	Tropical Forest Soil	QVIAMMGDAGTLGSPLPSPQQFVDLQYLHAAGIQ*
Ga0134076_106382241	3300012976	Grasslands Soil	KGLGQVIQFMGETGDLKPPLPSAERFVDLQYLRAVGIQ*
Ga0164309_113115963	3300012984	Soil	ELAGIAQVITFMAEAGQLKPPLPAPERFVDLRYQRR*
Ga0164306_105604491	3300012988	Soil	LAQVIAMMSDAGAIKTPLPSPEQFVDLQYLRRAGVP*
Ga0182008_105020311	3300014497	Rhizosphere	EQVIALMGEGGVLEPPLPPAERFVDLQFLAAAGVQ*
Ga0180082_10038484	3300014880	Soil	AQVIAFMAEAGQLKAPLPLPERFVDLQYLRLAGVR*
Ga0137412_102992822	3300015242	Vadose Zone Soil	MEQAITLMGESGVIKAPLPAAERFVDLQYLRAAGVQ*
Ga0182036_117192572	3300016270	Soil	NGLEQVIAMMAEARTLNPPLPSADRFVDLQYLRATGVQ
Ga0182037_103405071	3300016404	Soil	KLGEINLKGMEQVIALMAEGETINAPVPAAERFVDLQYLHAAGVQ
Ga0182037_106619323	3300016404	Soil	EQVIAMMAKARTLNPPLPSAERFVDLQYLRSAGVQ
Ga0182039_104319412	3300016422	Soil	LGEINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0182039_111904451	3300016422	Soil	GILPKLGEINLKGMEQVIALMAEGETIKPPLPAAERFGDLQYLHAAGVQ
Ga0163161_114317102	3300017792	Switchgrass Rhizosphere	DPKGVAQVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR
Ga0163161_117932242	3300017792	Switchgrass Rhizosphere	AQVIAFMGEGGMLAQPLPPPERFVDPQYLKAAGAE
Ga0066667_101739681	3300018433	Grasslands Soil	DIKGLGQVIQFMGETGDLKPPLPSAERFVDLQYLRAVGIQ
Ga0193743_11234123	3300019889	Soil	FVREGIIVEMISIEAETGDLKPPLPSAERFVDLQYLRAAGIQ
Ga0210405_113275262	3300021171	Soil	AQVIAFMTDGGAIKPPLPAPEQFVDLQYLRAAGAQ
Ga0210408_101998821	3300021178	Soil	GMEQVIALMGESATIKAPLPAAERFVDLQYLHAAGVQ
Ga0210408_104817611	3300021178	Soil	NLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0210397_107001452	3300021403	Soil	PKLGEISLKGMEQAIALMAEGGMIKPPLPAAEQFADLQYLRAVGVP
Ga0210394_118553691	3300021420	Soil	ELEALEQVIALMGEAGNLKAPLPSAERFVDTQYLRAAGAQ
Ga0213878_104688252	3300021444	Bulk Soil	LKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0210392_113951831	3300021475	Soil	VGNVIELLGRSGELKAPLPAAERFTDLQYLEAAGLQ
Ga0187846_102715871	3300021476	Biofilm	GLQQVIAMMGEEGLIGKPPPQASRFVDLQYLHAAGVQ
Ga0210398_100456675	3300021477	Soil	GQVIAFMGEGGTIKPPLPAPEQFVDLQYLRAAGAQ
Ga0207693_100143131	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	RGMEQVIALMGESATIKAPLPAAERFVDLQYLHAAGVQ
Ga0207686_114547592	3300025934	Miscanthus Rhizosphere	EQVIAFMGEAGNLTPPLPAAERFVDLQYLHAAGIK
Ga0207669_109260461	3300025937	Miscanthus Rhizosphere	QVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR
Ga0207712_117427202	3300025961	Switchgrass Rhizosphere	LKGMEQVIAFMREAGTLNEPVPTAERFTDLQYLRLAGIK
Ga0207648_108318741	3300026089	Miscanthus Rhizosphere	AQVIAFMGEGGMLPQPLPPPERFVDPQYLKAAGAE
Ga0207683_117565121	3300026121	Miscanthus Rhizosphere	MAQVIAFMAEAGTVKAPLPAPERFFDLRYLQSALPK
Ga0209234_12737543	3300026295	Grasslands Soil	MEQVIALMGESETIKAPLPAVERFVDLQYLHAAGVQ
Ga0209056_101481751	3300026538	Soil	EINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0209701_100676063	3300027862	Vadose Zone Soil	LELVIAMMGEGGALKAPLPQAERFVDLQYLRAAGVQ
Ga0209486_101126051	3300027886	Agricultural Soil	KGLAQVIAFMAEAGQIQPPLPDVERFVDLSYLARAGVR
Ga0209488_1000446012	3300027903	Vadose Zone Soil	DPKGFSAAIEFMGEAGVLKPPFPKPDQFIDLQYLQAAGIQ
Ga0209526_102768101	3300028047	Forest Soil	AGLAKVIELLAETGQIGAPPPPAERFVDLQYLQAAGLQ
Ga0307302_102648293	3300028814	Soil	QQAIALMEEGGLLAQPLPAAERFIDLQYLRAAGIQ
Ga0308198_10896561	3300030904	Soil	KGMEQAITLMGESGVIKAPLPAAERFVDLQYLRAAGVQ
Ga0307497_100125784	3300031226	Soil	AQVIAMMRDAGAIKTPLPSPEQFVDLQYLRAAGVP
Ga0318573_100416422	3300031564	Soil	INLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0318496_101442982	3300031713	Soil	LNGMEQVIALMAEGETINAPLPAAERFVDLQYLHAAGVQ
Ga0318500_100928152	3300031724	Soil	INLRGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0318500_103302962	3300031724	Soil	TGMEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ
Ga0306918_102454231	3300031744	Soil	LAGLKEVIALMGEAGNLKPPLPSAERFVDTRYLQAAGLQ
Ga0318554_106501261	3300031765	Soil	MQQAIAMLGESGVIKPPLPGAERFVDLQYLQAAGIQ
Ga0318498_102306272	3300031778	Soil	LKEVIALMGEAGNLKPPLPSAERFVDTQYLRAAGLQ
Ga0318566_100908512	3300031779	Soil	GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0318566_103037831	3300031779	Soil	LRGMEQVIALKAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0318567_100515121	3300031821	Soil	GEINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ
Ga0318517_100099613	3300031835	Soil	MEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ
Ga0306919_106562831	3300031879	Soil	NGLEQVIAMMAEARTINPPLPSAERFVDLQYLRAAGVQ
Ga0310916_106437422	3300031942	Soil	GLEQVIAFMGEAGNLKPPLPPAERFVELQYLHAAGVK
Ga0310910_107798671	3300031946	Soil	LKGMEQVIALMGESETIKAPLPAAERFVDLQYLHAAGVQ
Ga0318518_104566862	3300032090	Soil	EQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ
Ga0318519_100142153	3300033290	Soil	NLKGMEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ
Ga0372943_0113994_33_143	3300034268	Soil	LDQVIAFMGEGGALPAPLPPAARFVDLQYLRAAGVE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign