Basic Information | |
---|---|
Family ID | F101595 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 38 residues |
Representative Sequence | MDEEFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKT |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.90 % |
% of genes near scaffold ends (potentially truncated) | 15.69 % |
% of genes from short scaffolds (< 2000 bps) | 68.63 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.608 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.137 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.647 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00510 | COX3 | 33.33 |
PF01040 | UbiA | 32.35 |
PF02628 | COX15-CtaA | 6.86 |
PF01515 | PTA_PTB | 2.94 |
PF00072 | Response_reg | 1.96 |
PF00115 | COX1 | 1.96 |
PF13500 | AAA_26 | 0.98 |
PF13247 | Fer4_11 | 0.98 |
PF02790 | COX2_TM | 0.98 |
PF00814 | TsaD | 0.98 |
PF01757 | Acyl_transf_3 | 0.98 |
PF00293 | NUDIX | 0.98 |
PF00871 | Acetate_kinase | 0.98 |
PF02630 | SCO1-SenC | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 33.33 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 6.86 |
COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 2.94 |
COG0282 | Acetate kinase | Energy production and conversion [C] | 0.98 |
COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.98 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.65 % |
Unclassified | root | N/A | 32.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100685720 | Not Available | 1228 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101491018 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105717448 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1005332 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
3300001593|JGI12635J15846_10193373 | Not Available | 1352 | Open in IMG/M |
3300001593|JGI12635J15846_10537787 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100021739 | All Organisms → cellular organisms → Bacteria | 5532 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100202025 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100296717 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300005610|Ga0070763_10110046 | Not Available | 1399 | Open in IMG/M |
3300005764|Ga0066903_101035186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1505 | Open in IMG/M |
3300006028|Ga0070717_11134217 | Not Available | 712 | Open in IMG/M |
3300006048|Ga0075363_100040724 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
3300006176|Ga0070765_100011348 | All Organisms → cellular organisms → Bacteria | 6265 | Open in IMG/M |
3300009101|Ga0105247_10743964 | Not Available | 742 | Open in IMG/M |
3300009665|Ga0116135_1357048 | Not Available | 586 | Open in IMG/M |
3300009672|Ga0116215_1321231 | Not Available | 672 | Open in IMG/M |
3300010047|Ga0126382_10630211 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300010048|Ga0126373_10115618 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300010154|Ga0127503_11317512 | Not Available | 597 | Open in IMG/M |
3300010339|Ga0074046_10025971 | All Organisms → cellular organisms → Bacteria | 4035 | Open in IMG/M |
3300010339|Ga0074046_10875017 | Not Available | 524 | Open in IMG/M |
3300010376|Ga0126381_100093788 | All Organisms → cellular organisms → Bacteria | 3814 | Open in IMG/M |
3300012089|Ga0153924_1067290 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 704 | Open in IMG/M |
3300012096|Ga0137389_11750818 | Not Available | 517 | Open in IMG/M |
3300012202|Ga0137363_10019171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 4557 | Open in IMG/M |
3300012202|Ga0137363_10620269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 913 | Open in IMG/M |
3300012205|Ga0137362_11036689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 698 | Open in IMG/M |
3300012582|Ga0137358_10504190 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 815 | Open in IMG/M |
3300012683|Ga0137398_10221031 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300012961|Ga0164302_10861326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 691 | Open in IMG/M |
3300012971|Ga0126369_10107180 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
3300012971|Ga0126369_11985824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 670 | Open in IMG/M |
3300014164|Ga0181532_10024910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4255 | Open in IMG/M |
3300014165|Ga0181523_10015858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5169 | Open in IMG/M |
3300016319|Ga0182033_11873808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 545 | Open in IMG/M |
3300016357|Ga0182032_10062609 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
3300018034|Ga0187863_10530771 | Not Available | 660 | Open in IMG/M |
3300020579|Ga0210407_10353667 | Not Available | 1149 | Open in IMG/M |
3300020579|Ga0210407_10871402 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300020580|Ga0210403_10310103 | Not Available | 1293 | Open in IMG/M |
3300020581|Ga0210399_10751774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 799 | Open in IMG/M |
3300020582|Ga0210395_10079270 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300021046|Ga0215015_10762792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1783 | Open in IMG/M |
3300021171|Ga0210405_10197467 | Not Available | 1595 | Open in IMG/M |
3300021178|Ga0210408_11374947 | Not Available | 533 | Open in IMG/M |
3300021180|Ga0210396_10173648 | Not Available | 1931 | Open in IMG/M |
3300021361|Ga0213872_10014368 | All Organisms → cellular organisms → Bacteria | 3694 | Open in IMG/M |
3300021361|Ga0213872_10061399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1699 | Open in IMG/M |
3300021372|Ga0213877_10000055 | All Organisms → cellular organisms → Bacteria | 12756 | Open in IMG/M |
3300021377|Ga0213874_10005232 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
3300021384|Ga0213876_10278494 | Not Available | 889 | Open in IMG/M |
3300021401|Ga0210393_10083303 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300021401|Ga0210393_10175709 | Not Available | 1727 | Open in IMG/M |
3300021401|Ga0210393_11011224 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300021402|Ga0210385_10133836 | Not Available | 1760 | Open in IMG/M |
3300021405|Ga0210387_10488573 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
3300021439|Ga0213879_10061575 | Not Available | 1008 | Open in IMG/M |
3300021479|Ga0210410_10218904 | Not Available | 1707 | Open in IMG/M |
3300021479|Ga0210410_10474712 | Not Available | 1118 | Open in IMG/M |
3300021559|Ga0210409_10107492 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
3300021560|Ga0126371_10355587 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300021560|Ga0126371_10461315 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300022530|Ga0242658_1144571 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 608 | Open in IMG/M |
3300022557|Ga0212123_10019410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium | 7910 | Open in IMG/M |
3300024227|Ga0228598_1107932 | Not Available | 563 | Open in IMG/M |
3300025910|Ga0207684_10017158 | All Organisms → cellular organisms → Bacteria | 6214 | Open in IMG/M |
3300025922|Ga0207646_10084853 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300026551|Ga0209648_10718242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
3300026557|Ga0179587_10294985 | Not Available | 1044 | Open in IMG/M |
3300027063|Ga0207762_1030858 | Not Available | 819 | Open in IMG/M |
3300027109|Ga0208603_1054503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 606 | Open in IMG/M |
3300027635|Ga0209625_1112717 | Not Available | 610 | Open in IMG/M |
3300027651|Ga0209217_1110983 | Not Available | 778 | Open in IMG/M |
3300027651|Ga0209217_1167007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 604 | Open in IMG/M |
3300027680|Ga0207826_1047273 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300027727|Ga0209328_10019673 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300027727|Ga0209328_10039284 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300027738|Ga0208989_10110452 | Not Available | 935 | Open in IMG/M |
3300027738|Ga0208989_10198056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 665 | Open in IMG/M |
3300027812|Ga0209656_10006356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 7592 | Open in IMG/M |
3300027812|Ga0209656_10015023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4813 | Open in IMG/M |
3300027825|Ga0209039_10002094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 17414 | Open in IMG/M |
3300027908|Ga0209006_10114018 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
3300027908|Ga0209006_10282245 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300028047|Ga0209526_10098614 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300028047|Ga0209526_10602115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. AZCC_0083 | 704 | Open in IMG/M |
3300028780|Ga0302225_10275330 | Not Available | 800 | Open in IMG/M |
3300028798|Ga0302222_10322320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 602 | Open in IMG/M |
3300028906|Ga0308309_10046222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3106 | Open in IMG/M |
3300030007|Ga0311338_11080143 | Not Available | 772 | Open in IMG/M |
3300030618|Ga0311354_10827637 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300030740|Ga0265460_12779569 | Not Available | 525 | Open in IMG/M |
3300031231|Ga0170824_122598738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
3300031819|Ga0318568_10969738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 525 | Open in IMG/M |
3300031962|Ga0307479_10980020 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300032160|Ga0311301_10050661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 9516 | Open in IMG/M |
3300032174|Ga0307470_11839272 | Not Available | 514 | Open in IMG/M |
3300032261|Ga0306920_103834191 | Not Available | 549 | Open in IMG/M |
3300032829|Ga0335070_10281905 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300032955|Ga0335076_10081776 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
3300033289|Ga0310914_11601625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 555 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.61% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 16.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.96% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1006857202 | 3300000364 | Soil | MQEDYKKKNRRLFIAIVVFAIGFTVLIILWKLSIYQKI* |
INPhiseqgaiiFebDRAFT_1014910182 | 3300000364 | Soil | MDKNLRKKNRRLLIAIIIFALALCAIVILWKLSIYQKI* |
INPhiseqgaiiFebDRAFT_1057174483 | 3300000364 | Soil | MDEDLRKKNRRLLIGIIIFALALCAIVILWKLSIYQKI* |
AP72_2010_repI_A001DRAFT_10053323 | 3300000893 | Forest Soil | MDEELRRKNRRLWIALVTFAILLTLLVILWKLSIYQKF* |
JGI12635J15846_101933732 | 3300001593 | Forest Soil | MEEEVRKKNRRLLIAIVVFAIGFTVLIILWKLSIYQKT* |
JGI12635J15846_105377872 | 3300001593 | Forest Soil | MQEDYRKKNRRLLIVFIVFAVGFTVAIILWKLSIYQKF* |
JGIcombinedJ26739_1000217394 | 3300002245 | Forest Soil | MDEELRKKNRRLWIALVAFAILLTLLVILWKLSIYQKI* |
JGIcombinedJ26739_1002020252 | 3300002245 | Forest Soil | MDENLRKKNRRLLIAIIIFALALGAIVILWKLSIYQKI* |
JGIcombinedJ26739_1002967173 | 3300002245 | Forest Soil | MEEDYKKKNRRLLIAMIIFAVGFTVIIILWKLSIYQKF* |
Ga0070763_101100463 | 3300005610 | Soil | MEQDFRKKNRRLLIAFIVFAVGFTLLIILWKLSIYQKT* |
Ga0066903_1010351862 | 3300005764 | Tropical Forest Soil | MDENLRKKNRRLLIAMMIFAIALCIIVILWKLSIYQKI* |
Ga0070717_111342172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEKFRKKNRRMLVAILVFAIGFTVLIILWKLSIYQKS* |
Ga0075363_1000407243 | 3300006048 | Populus Endosphere | MDEKLRKKNRCLLIGMIIFALLLTLIVILWKLSIYQKI* |
Ga0070765_1000113482 | 3300006176 | Soil | MNEDFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT* |
Ga0105247_107439641 | 3300009101 | Switchgrass Rhizosphere | MEDNYRKKNRRLLVAILVFAIGFTVLIILWKLSIYQK* |
Ga0116135_13570481 | 3300009665 | Peatland | MDEDFRKKNRRLAVAIVVFAVGLTVLIIVWKLSIYHKTLTP* |
Ga0116215_13212312 | 3300009672 | Peatlands Soil | MDEEFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKT* |
Ga0126382_106302112 | 3300010047 | Tropical Forest Soil | MDENLRKKNRRLLIAIVIFALTLCAVVILWKLSIYQKI* |
Ga0126373_101156183 | 3300010048 | Tropical Forest Soil | MDDEFRKKNRRLLIAIILFAVGLTILVILWKLSIYQKT* |
Ga0127503_113175122 | 3300010154 | Soil | MDENLRKKNRRLLIAIIIFALALCAIVILWKLSIYQKI* |
Ga0074046_100259714 | 3300010339 | Bog Forest Soil | MDEDFRKKNRRLAIAIVVFAVGLTVLIILWKLSIYQKT* |
Ga0074046_108750172 | 3300010339 | Bog Forest Soil | MDQDFRKKNRRLAIAIVVFAVGLTVLIILWKLSIYQKT* |
Ga0126381_1000937883 | 3300010376 | Tropical Forest Soil | MDENLRKKNRRLLIAMMIFAIALCIIVILWKLAIYQKI* |
Ga0153924_10672902 | 3300012089 | Attine Ant Fungus Gardens | MDEDFRKKNRRMAIAIFVFAVGFTVLIILWKLSIYQKT* |
Ga0137389_117508182 | 3300012096 | Vadose Zone Soil | VKDDEIRKNNRRLLIAIIIFALGLTLLVILWKLSIYQKT* |
Ga0137363_100191718 | 3300012202 | Vadose Zone Soil | MDENLRKKNRRLLIAIVIFALTLCAIVILWKLSIYQKI* |
Ga0137363_106202692 | 3300012202 | Vadose Zone Soil | MQEEYKKKNRRLFIAIVVFAVGFTLLIILWKLSIYQKV* |
Ga0137362_110366892 | 3300012205 | Vadose Zone Soil | MNEEFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT* |
Ga0137358_105041902 | 3300012582 | Vadose Zone Soil | MNEEFRKKNRRLLIAIIIFAVGLTLLIILWKLSIYQKT* |
Ga0137398_102210312 | 3300012683 | Vadose Zone Soil | MEEDFKKKNRRLLIAMIIFAVGFTVLIILWKLSIYQKV* |
Ga0164302_108613262 | 3300012961 | Soil | MDEKFRKSNRRLLIAIIVFALGLTLLVILWKLSIYQKP* |
Ga0126369_101071803 | 3300012971 | Tropical Forest Soil | MDDEFRKKNRRLLIAIILFAIGLALLVILWKLSIYQKT* |
Ga0126369_119858242 | 3300012971 | Tropical Forest Soil | ILMDENLRKKNRRLLIAMMIFAIALCIIVILWKLSIYQKI* |
Ga0181532_100249104 | 3300014164 | Bog | MDEDFRRKNRRLAIAIVIFAVGLTVLIILWKLSIYQKT* |
Ga0181523_100158581 | 3300014165 | Bog | MDEDFRRKNRRLAIAIVVFAVGLTVLIILWKLSIYQKT* |
Ga0182033_118738082 | 3300016319 | Soil | PIVMDDEFRKKNRRLLIAIILFAIGLTLLVILWKLSIYQKT |
Ga0182032_100626092 | 3300016357 | Soil | MDENLRKKNRRLLIAIMIFAITLCIIVILWKLSIYQKI |
Ga0187863_105307712 | 3300018034 | Peatland | MDEDFRKKNRRLAVAIVVFAVGLTVLIIVWKLSIYHKTLTP |
Ga0210407_103536673 | 3300020579 | Soil | RTIVMEQDFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKT |
Ga0210407_108714022 | 3300020579 | Soil | MQEEYKKKNRRLFIAIVVFAVGFTLLIILWKLSIYQKI |
Ga0210403_103101033 | 3300020580 | Soil | MEQDFRKKNRRLLIAFIVFAVGFTLLIILWKLSIYQKT |
Ga0210399_107517742 | 3300020581 | Soil | MDENLRKKNRRLLIAIVIFALTLCAIVILWKLSIYQKI |
Ga0210395_100792703 | 3300020582 | Soil | MEEKFRKKNRRMLVAILVFAIGFTVLIILWKLSIYQKS |
Ga0215015_107627922 | 3300021046 | Soil | MNEELKKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0210405_101974673 | 3300021171 | Soil | MQEEYKKKNRRLFIAIVVFAIGFTLLIILWKLSIYQKV |
Ga0210408_113749472 | 3300021178 | Soil | MQEEYKKKNRRLFIAIVIFAVGFTLLIILWKLSIYQKI |
Ga0210396_101736481 | 3300021180 | Soil | EDKFRDKNRRMFVAIVVFAIGFTVLIILWKLSIYQKG |
Ga0213872_100143683 | 3300021361 | Rhizosphere | MDEELRKKNRRILIAIIAFAVGLTLLIILWKLSIYQKT |
Ga0213872_100613991 | 3300021361 | Rhizosphere | MDEDFRKKNRRLAIVLIVFAVGLTILIILWKLSIYQRT |
Ga0213877_100000556 | 3300021372 | Bulk Soil | MDEDFRKKNRRLAIVLIAFAVGLTILIILWKLSIYQRP |
Ga0213874_100052323 | 3300021377 | Plant Roots | MGKDLKRKNRRLLIALIVFAIGFTILIILWKLSIYQKF |
Ga0213876_102784942 | 3300021384 | Plant Roots | MSLKDELHKKNLRFLAGMILFALLLALVVILWKLSIYQPA |
Ga0210393_100833033 | 3300021401 | Soil | MENKFRNKNRRMFVAIVVFAIGFTVLIILWKLSIYQKG |
Ga0210393_101757094 | 3300021401 | Soil | MEQDFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKI |
Ga0210393_110112242 | 3300021401 | Soil | MQEDYRKKNRRLLIVFIVFAVGFTVAIILWKLSIYQKF |
Ga0210385_101338363 | 3300021402 | Soil | MEDKFRDKNRRMFVAIVVFAIGFTVLIILWKLSIYQKG |
Ga0210387_104885732 | 3300021405 | Soil | MEEEFRKKNRRMLVAILVFAIGFTVLIILWKLSIYQKS |
Ga0213879_100615751 | 3300021439 | Bulk Soil | RPRFCPFVMDEDFRRKNRRLVIVLVAFAVGLTILIILWKLSIYQRT |
Ga0210410_102189043 | 3300021479 | Soil | MEQDFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKT |
Ga0210410_104747123 | 3300021479 | Soil | MQEEYKKKNRRLFIAIVVFAVGFTLLIILWKLSIYQKF |
Ga0210409_101074923 | 3300021559 | Soil | MNEDFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0126371_103555872 | 3300021560 | Tropical Forest Soil | MDENLRKKNRRLLIAMMIFAIALCIIVILWKLSIYQKI |
Ga0126371_104613153 | 3300021560 | Tropical Forest Soil | MDENLRKKNRRLLIAIVIFALALCAIVILWKLSIYQKI |
Ga0242658_11445711 | 3300022530 | Soil | PIVMEEKFRKKNRRMLVAILVFAIGFTVLIILWKLSIYQKS |
Ga0212123_100194103 | 3300022557 | Iron-Sulfur Acid Spring | MNEEFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0228598_11079322 | 3300024227 | Rhizosphere | MDEDFRKKNRRMAIAIVVFAVGFTVLIILWKLSIYHKILTP |
Ga0207684_100171582 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEELRRKNRRLWIALVVFAILLTLLVILWKLSIYQKF |
Ga0207646_100848533 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDENLRKKNRRLLIAIVIFALALCTIVILWKLSIYQKI |
Ga0209648_107182421 | 3300026551 | Grasslands Soil | IVMNEKLRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0179587_102949852 | 3300026557 | Vadose Zone Soil | MQEEYKKKNRRLFIAIVIFAIGFTVLIILWKLSIYQKI |
Ga0207762_10308581 | 3300027063 | Tropical Forest Soil | NEEFRKKNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0208603_10545032 | 3300027109 | Forest Soil | IVMNEDFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0209625_11127172 | 3300027635 | Forest Soil | MEEEVRKKNRRLLIAIVVFAIGFTVLIILWKLSIYQKT |
Ga0209217_11109832 | 3300027651 | Forest Soil | VRPIIMEEEFRRKNRRLLMALIVFAVGFTVLIILWKLSIYQKP |
Ga0209217_11670072 | 3300027651 | Forest Soil | ENLRKKNRRLLIAIIIFALALGAIVILWKLSIYQKI |
Ga0207826_10472732 | 3300027680 | Tropical Forest Soil | MNEEFRKKNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0209328_100196733 | 3300027727 | Forest Soil | MDEELRKKNRRLWIALVAFAILLTLLVILWKLSIYQKI |
Ga0209328_100392842 | 3300027727 | Forest Soil | MDENLRKKNRRLLIAIIIFALALGAIVILWKLSIYQKI |
Ga0208989_101104522 | 3300027738 | Forest Soil | MIDEELRKKNRRFLIVMIIFALCLTAAVIVWKLSIYQVPH |
Ga0208989_101980561 | 3300027738 | Forest Soil | MIDEELRKKNRRLLIAIIVFALLLTTAVIVWKLSIYQVPQK |
Ga0209656_100063565 | 3300027812 | Bog Forest Soil | MDQDFRKKNRRLAIAIVVFAVGLTVLIILWKLSIYQKT |
Ga0209656_100150234 | 3300027812 | Bog Forest Soil | MDEDFRKKNRRLAIAIVVFAVGLTVLIILWKLSIYQKT |
Ga0209039_1000209416 | 3300027825 | Bog Forest Soil | MKEELRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0209006_101140183 | 3300027908 | Forest Soil | MEEERRKKNRRMVIALLIFAILFTLLIILWKLSIYQKT |
Ga0209006_102822452 | 3300027908 | Forest Soil | MEENYRKKNRRMLIAILVFVIGFTILIILWKLSIYQKT |
Ga0209526_100986143 | 3300028047 | Forest Soil | MEEDYKKKNRRLLIAMIIFAVGFTVIIILWKLSIYQKV |
Ga0209526_106021152 | 3300028047 | Forest Soil | LYEDMIDEELRKKNRRFLIVMIIFALCLTAAVILWKLSIYQVPH |
Ga0302225_102753302 | 3300028780 | Palsa | MQEEYRKKNRRLFIAIIVFAIGFTALIILWKLSIYQKI |
Ga0302222_103223202 | 3300028798 | Palsa | RFRPIVMQEEYRKKNRRLFIAIIVFAIGFTALIILWKLSIYQKI |
Ga0308309_100462221 | 3300028906 | Soil | CPIVMNEDFRKNNRRLLIAIIIFAVGLTLLVILWKLSIYQKT |
Ga0311338_110801432 | 3300030007 | Palsa | MQEEYRKKNRRLLIVFIVFAVGFTVAIILWKLSIYQKI |
Ga0311354_108276372 | 3300030618 | Palsa | MQEEYRKKNRRLLIVFIVFAVGFTVAIILWKLSIYQKF |
Ga0265460_127795692 | 3300030740 | Soil | MEEERRKKNRRMVIALLIFALGFTILIILWKLSIYQ |
Ga0170824_1225987382 | 3300031231 | Forest Soil | MEEKFRKKNRRMLVAILVFAIGFTVLIILWKLSIYQRS |
Ga0318568_109697382 | 3300031819 | Soil | MDENLRKKNRRLLIAIMIFAITLCIIVILWKLSIYQKF |
Ga0307479_109800202 | 3300031962 | Hardwood Forest Soil | MDEEYRKKNRRLLIAIIVFAVVFTLLIILWKLSIYQKT |
Ga0311301_100506615 | 3300032160 | Peatlands Soil | MDEEFRKKNRRLLIAIIVFAVGFTLLIILWKLSIYQKT |
Ga0307470_118392722 | 3300032174 | Hardwood Forest Soil | MQEEYKKKNRRLFIAIVVFAIGFTVLIILWKLSIYQKI |
Ga0306920_1038341912 | 3300032261 | Soil | MDENLRKKNRRLLIAIMIFAIALCIIVILWKLSIYQKI |
Ga0335070_102819053 | 3300032829 | Soil | MDKELRKKNRYLLIGMIIFALLLTLIVILWKLSIYQKV |
Ga0335076_100817764 | 3300032955 | Soil | MDEDFRKKNRRLAIVLIAFAVALTILIILWKLSIYQKT |
Ga0310914_116016251 | 3300033289 | Soil | VMDEELRRKNRRLWIALVTFAILLTLLVILWKLSIYQKF |
⦗Top⦘ |