NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101609

Metagenome / Metatranscriptome Family F101609

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101609
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 44 residues
Representative Sequence FGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT
Number of Associated Samples 89
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.92 %
% of genes near scaffold ends (potentially truncated) 88.24 %
% of genes from short scaffolds (< 2000 bps) 91.18 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.549 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.314 % of family members)
Environment Ontology (ENVO) Unclassified
(30.392 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.216 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.19%    β-sheet: 20.29%    Coil/Unstructured: 56.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08450SGL 53.92
PF00293NUDIX 5.88
PF02720DUF222 3.92
PF00920ILVD_EDD 2.94
PF12706Lactamase_B_2 2.94
PF07690MFS_1 1.96
PF00155Aminotran_1_2 0.98
PF03988DUF347 0.98
PF00884Sulfatase 0.98
PF01230HIT 0.98
PF13520AA_permease_2 0.98
PF01136Peptidase_U32 0.98
PF07592DDE_Tnp_ISAZ013 0.98
PF01636APH 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 53.92
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 53.92
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 5.88
COG082623S rRNA C2501 and tRNA U34 5'-hydroxylation protein RlhA/YrrN/YrrO, U32 peptidase familyTranslation, ribosomal structure and biogenesis [J] 0.98
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.55 %
UnclassifiedrootN/A27.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01CQ05CAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales626Open in IMG/M
3300004091|Ga0062387_101773131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica503Open in IMG/M
3300005172|Ga0066683_10784242All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005343|Ga0070687_100915723All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300005434|Ga0070709_10389212Not Available1038Open in IMG/M
3300005437|Ga0070710_10531510All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005439|Ga0070711_101578757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005535|Ga0070684_100858847All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005553|Ga0066695_10699002All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005563|Ga0068855_101365239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300005617|Ga0068859_102100302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300006050|Ga0075028_100694300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300006059|Ga0075017_100315842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1157Open in IMG/M
3300006175|Ga0070712_101412333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300006175|Ga0070712_101681043All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300006175|Ga0070712_102045579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300006176|Ga0070765_100134173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2189Open in IMG/M
3300006575|Ga0074053_11484943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300009092|Ga0105250_10323432All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300009098|Ga0105245_12525393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300009174|Ga0105241_12357100All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300009522|Ga0116218_1132682Not Available1132Open in IMG/M
3300010046|Ga0126384_12152780All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010047|Ga0126382_10201831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1415Open in IMG/M
3300010047|Ga0126382_10699860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300010301|Ga0134070_10438216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300010329|Ga0134111_10513272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300010339|Ga0074046_10872232Not Available525Open in IMG/M
3300010343|Ga0074044_10444533Not Available848Open in IMG/M
3300010376|Ga0126381_104263727Not Available554Open in IMG/M
3300010379|Ga0136449_101291089Not Available1139Open in IMG/M
3300012200|Ga0137382_10759389All Organisms → cellular organisms → Bacteria → Terrabacteria group696Open in IMG/M
3300012285|Ga0137370_10512936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300012357|Ga0137384_10051893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3395Open in IMG/M
3300012357|Ga0137384_10374779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1177Open in IMG/M
3300012357|Ga0137384_10501079Not Available997Open in IMG/M
3300012363|Ga0137390_10990724Not Available793Open in IMG/M
3300012502|Ga0157347_1003579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1399Open in IMG/M
3300012989|Ga0164305_10258834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1262Open in IMG/M
3300016270|Ga0182036_11936209All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300016294|Ga0182041_11511790All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300016422|Ga0182039_11386622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300017926|Ga0187807_1124502Not Available817Open in IMG/M
3300017972|Ga0187781_10765675Not Available700Open in IMG/M
3300017973|Ga0187780_11201414Not Available556Open in IMG/M
3300017974|Ga0187777_10487445All Organisms → cellular organisms → Bacteria → Terrabacteria group860Open in IMG/M
3300018001|Ga0187815_10066556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1515Open in IMG/M
3300018001|Ga0187815_10334889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300018032|Ga0187788_10536345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300018086|Ga0187769_10743402Not Available742Open in IMG/M
3300020581|Ga0210399_10699428All Organisms → cellular organisms → Bacteria → Terrabacteria group833Open in IMG/M
3300021088|Ga0210404_10591543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300021180|Ga0210396_10721948Not Available859Open in IMG/M
3300021181|Ga0210388_10643251All Organisms → cellular organisms → Bacteria → Terrabacteria group926Open in IMG/M
3300021401|Ga0210393_11116824All Organisms → cellular organisms → Bacteria → Terrabacteria group636Open in IMG/M
3300021407|Ga0210383_10211419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1660Open in IMG/M
3300021432|Ga0210384_10881238All Organisms → cellular organisms → Bacteria → Terrabacteria group795Open in IMG/M
3300021479|Ga0210410_11350671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300024288|Ga0179589_10445203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300025915|Ga0207693_10739553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300025916|Ga0207663_10367045Not Available1093Open in IMG/M
3300025927|Ga0207687_11559274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300025932|Ga0207690_10848540All Organisms → cellular organisms → Bacteria → Terrabacteria group756Open in IMG/M
3300027047|Ga0208730_1032585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae606Open in IMG/M
3300027604|Ga0208324_1169118Not Available589Open in IMG/M
3300027812|Ga0209656_10046656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2474Open in IMG/M
3300028782|Ga0307306_10253135All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300028906|Ga0308309_10158257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1830Open in IMG/M
3300028906|Ga0308309_10229326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1544Open in IMG/M
3300031543|Ga0318516_10617147Not Available619Open in IMG/M
3300031543|Ga0318516_10766226All Organisms → cellular organisms → Bacteria → Terrabacteria group546Open in IMG/M
3300031544|Ga0318534_10236456Not Available1054Open in IMG/M
3300031640|Ga0318555_10010223All Organisms → cellular organisms → Bacteria4098Open in IMG/M
3300031668|Ga0318542_10571881Not Available589Open in IMG/M
3300031680|Ga0318574_10023656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3030Open in IMG/M
3300031680|Ga0318574_10073380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1852Open in IMG/M
3300031713|Ga0318496_10538330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter gotjawali645Open in IMG/M
3300031723|Ga0318493_10328980Not Available828Open in IMG/M
3300031740|Ga0307468_100854200Not Available783Open in IMG/M
3300031751|Ga0318494_10050368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2199Open in IMG/M
3300031765|Ga0318554_10041257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2507Open in IMG/M
3300031769|Ga0318526_10077238Not Available1308Open in IMG/M
3300031770|Ga0318521_10230246Not Available1077Open in IMG/M
3300031770|Ga0318521_10679373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300031792|Ga0318529_10383979Not Available654Open in IMG/M
3300031797|Ga0318550_10365621Not Available699Open in IMG/M
3300031797|Ga0318550_10478866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300031835|Ga0318517_10211805All Organisms → cellular organisms → Bacteria → Terrabacteria group874Open in IMG/M
3300031910|Ga0306923_10954423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia935Open in IMG/M
3300031946|Ga0310910_11046401Not Available637Open in IMG/M
3300031947|Ga0310909_10978984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae692Open in IMG/M
3300032009|Ga0318563_10639040Not Available573Open in IMG/M
3300032039|Ga0318559_10104923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1254Open in IMG/M
3300032041|Ga0318549_10275994All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300032042|Ga0318545_10057706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300032055|Ga0318575_10167949Not Available1096Open in IMG/M
3300032055|Ga0318575_10378160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae718Open in IMG/M
3300032066|Ga0318514_10037227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2308Open in IMG/M
3300032205|Ga0307472_100771458Not Available874Open in IMG/M
3300032770|Ga0335085_10228729All Organisms → cellular organisms → Bacteria2253Open in IMG/M
3300032770|Ga0335085_11235472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae792Open in IMG/M
3300033158|Ga0335077_10841865All Organisms → cellular organisms → Bacteria930Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_012416802170459017Switchgrass, Maize And Mischanthus LitterMVWTNLFGVISFELFGQLRNVVAEPPAGRDAFFAESIRRWLEFTAIT
Ga0062387_10177313113300004091Bog Forest SoilMAWTGLFGLVSFELYGQLHEVVGENPGDRDAFFVECVRRWIHLVGIA*
Ga0066683_1078424213300005172SoilVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWTTFIIGLTVSS*
Ga0070687_10091572313300005343Switchgrass RhizosphereISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP*
Ga0070709_1038921223300005434Corn, Switchgrass And Miscanthus RhizosphereFGVISFELFGQLHNVVAEPPVGRDAFFAECIRRWITFTAIT*
Ga0070710_1053151023300005437Corn, Switchgrass And Miscanthus RhizosphereALMVWTNLFGVISFELFGQLRNVVAEPPAGRDAFFAECIRRWITFTAIT*
Ga0070711_10157875723300005439Corn, Switchgrass And Miscanthus RhizosphereVVSFELYGQLHNVVGEESGDREAFFAECIRRWIQLTGIA*
Ga0070684_10085884713300005535Corn RhizosphereWTNLFGVISFELFGQLHNVVAEPPADRDAFFAESIRRWLEFTAITP*
Ga0066695_1069900213300005553SoilVISFELFGQLHNVVAEPPAGRDAFFAECIRHWTTFTAIT*
Ga0068855_10136523923300005563Corn RhizosphereVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIT*
Ga0068859_10210030223300005617Switchgrass RhizosphereWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS*
Ga0075028_10069430023300006050WatershedsMVWTNLFGVVSFELYGQLHSVVGEEPGDREAFFAECIRRWIHLTGIT*
Ga0075017_10031584223300006059WatershedsVQRALMVWTNLFGVISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA*
Ga0070712_10141233313300006175Corn, Switchgrass And Miscanthus RhizosphereVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT*
Ga0070712_10168104313300006175Corn, Switchgrass And Miscanthus RhizosphereFGVISFELFGQLHNVVAEPPAGRDAFFAASIRHWITFTAIT*
Ga0070712_10204557913300006175Corn, Switchgrass And Miscanthus RhizosphereLMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP*
Ga0070765_10013417323300006176SoilMASITSLFGTVSFELYGQLHQVVADPPADREAFFATCIRHWTDFINLRVVP*
Ga0074053_1148494313300006575SoilFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS*
Ga0105250_1032343223300009092Switchgrass RhizosphereELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAITP*
Ga0105245_1252539323300009098Miscanthus RhizosphereALMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT*
Ga0105241_1235710013300009174Corn RhizosphereVISFELFGQLHNVVAEPPAGRDAFFAASIRHWITITAIT*
Ga0116218_113268223300009522Peatlands SoilMVWTGLFGLISFELNGQRPQVVGRNPGDRDAFFAECVRRWICFIGIG*
Ga0126384_1215278013300010046Tropical Forest SoilLMVWTNLFGVISFELFGQLHSVVGEDPADRDVFFAECIRYWITFTAIGRSPSSV*
Ga0126382_1020183113300010047Tropical Forest SoilVSFELFGQLHNVVADDPPDRDTFFAESIRHWLTFTGIT*
Ga0126382_1069986023300010047Tropical Forest SoilVWTNLFGVISFELFGQLHNVVAEPSADRDAFFAESIRRWLTFTAIT*
Ga0134070_1043821623300010301Grasslands SoilSFELFGQLHNVVAEPPAGRDAFFAECVRRWITFTAIT*
Ga0134111_1051327223300010329Grasslands SoilSFELFSQLHNVVAEPPADRDAFFAECIHRWITFTAIT*
Ga0074046_1087223213300010339Bog Forest SoilMAWTGLSGVISFELNGQRRQVVGRNPGDRDAFFAECVRHWICFTGLG*
Ga0074044_1044453323300010343Bog Forest SoilMVWTNLFGVISFELYGQLHEVVGEGPGDRDAFFAECVRRWIQSIGI*
Ga0126381_10426372723300010376Tropical Forest SoilQRALMAWTGLFGVVSFDLYGQLHQVVGEEPADRDTFFAECIRRWLQFMNLG*
Ga0136449_10129108923300010379Peatlands SoilVVSFELYGQLHEVVEEEPGDRDAFFAECVRHWIQFVGI*
Ga0137382_1075938923300012200Vadose Zone SoilFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT*
Ga0137370_1051293623300012285Vadose Zone SoilVVSFELFGQLHNVVAEPPADRDAFFAECIRRWTTFTAIT*
Ga0137384_1005189313300012357Vadose Zone SoilALMVWTNLFGVISFELYGQLHEVVGEAPGDRDAFFTECVRRWIQFVGIA*
Ga0137384_1037477933300012357Vadose Zone SoilTNLFGVISFELFGQLHNVVAEPPADRDAFFAESIRRWLAFTAIT*
Ga0137384_1050107923300012357Vadose Zone SoilVSFALFGQLHNVVAEPPADRDAFFAECIRRWTTFTAIT*
Ga0137390_1099072423300012363Vadose Zone SoilISFELYGQLHNVVGEAPAARDAFFAECIRRWIHFTSIT*
Ga0157347_100357913300012502Arabidopsis RhizosphereLFGQLHNVVAEPPGGRDAFFAECIRRWTTFTAIT*
Ga0164305_1025883433300012989SoilFGQLHTVVAEPPFGRDAFFAESIRRWLEFTAITP*
Ga0182036_1193620923300016270SoilVSFEVFGQLHNVVGEDPADRDAFFAECVRRWITFTPIT
Ga0182041_1151179023300016294SoilVVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIP
Ga0182039_1138662223300016422SoilWTNLFGVVSFELFGQLHNVVAEDPADRDAFFAECVRHWITFTNLT
Ga0187807_112450233300017926Freshwater SedimentMVWTGLFGVISFELYGQLHQVVGEGPADRDTFFAECIRRWLQFMNLA
Ga0187781_1076567523300017972Tropical PeatlandMVWTGLFGVVSFELYGQLHQVIGDDRPDRDAFFAECVTRWITFMKLS
Ga0187780_1120141413300017973Tropical PeatlandELYGQLRNVVGENPGDRGTFFAECVRRWIHFTGLA
Ga0187777_1048744533300017974Tropical PeatlandSFELYGQLHQVVGEEPADRDTFFAECIRRWLGFMDLG
Ga0187815_1006655633300018001Freshwater SedimentELYGQLHQVVAEKPADRDTFFAECIRRWLQFMNLG
Ga0187815_1033488923300018001Freshwater SedimentLVQRGLMAWTGLFGVVSFELYGQLHQVVAEDPAGREAFFAECISRWITFVGLTNGR
Ga0187788_1053634513300018032Tropical PeatlandMVWTNLFGVISFELFGQLHNVVGEEPGDRDAFFADCARRWFR
Ga0187769_1074340213300018086Tropical PeatlandGLFGVVSFELYGQLHQVVAEDPADRDAFFAECISRWITFVGLT
Ga0210399_1069942813300020581SoilVWTNLFGVISFELFGQLHNVIAEPPAGHDAFFAECIRRWITFTAIT
Ga0210404_1059154323300021088SoilGVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT
Ga0210396_1072194813300021180SoilSFELYGQLHEVVGENPGDRDAFFVECVRRWIHLVGIA
Ga0210388_1064325113300021181SoilRVGVISFELYGQLHQVVGEEPGDRDTFFAACIHRWIRFTGIA
Ga0210393_1111682413300021401SoilISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA
Ga0210383_1021141943300021407SoilGVISFELYGQLHQVVGEEPGDRDTFFAECIHRWIRFTGIA
Ga0210384_1088123813300021432SoilFGVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT
Ga0210410_1135067113300021479SoilLMVWTNLFGVISFELFGQLHNVIAEPPAGRDAFFAECIRRWITFTAIT
Ga0179589_1044520313300024288Vadose Zone SoilGVVSFELFGQLHNVVAEPPAGRDAFFAECIRRWTTFTAIT
Ga0207693_1073955323300025915Corn, Switchgrass And Miscanthus RhizosphereNLFGVISFELFGQLHNVVAEPPAGRDAFFAASIRHWITFTAIT
Ga0207663_1036704513300025916Corn, Switchgrass And Miscanthus RhizosphereRALMVWTNLFGVVSFELFGQLHSVVAEEPGDRAAFFTECIRRWLAFTAVS
Ga0207687_1155927423300025927Miscanthus RhizosphereALMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAECIRRWITFTAIT
Ga0207690_1084854013300025932Corn RhizosphereTLMVWTNLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS
Ga0208730_103258513300027047Forest SoilMASITSLFGTVSFELYGQLHEVVAEAPADREAFFATCIRHWTDFINLRVVP
Ga0208324_116911813300027604Peatlands SoilMVWTGLFGLISFELNGQRPQVVGRNPGDRDAFFAECVRRWICFIGIG
Ga0209656_1004665633300027812Bog Forest SoilMAWTGLSGVISFELNGQRRQVVGRNPGDRDAFFAECVRHWICFTGLG
Ga0307306_1025313513300028782SoilNLFGVISFELFGQLRNVVAEPPAGRDAFFAESIRRWFAFTAIT
Ga0308309_1015825723300028906SoilMASITSLFGTVSFELYGQLHQVVADPPADREAFFATCIRHWTDFINLRVVP
Ga0308309_1022932633300028906SoilFELYGQLHQVIGEPPADRDAFFAECVHGWLQFMNLG
Ga0318516_1061714723300031543SoilALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318516_1076622623300031543SoilVWTNLFGVVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT
Ga0318534_1023645623300031544SoilQRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG
Ga0318555_1001022353300031640SoilFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318542_1057188123300031668SoilTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318574_1002365613300031680SoilLMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318574_1007338033300031680SoilVISFELFGQLHNVVEEDPADRDAFFADCIRRWITFTAMT
Ga0318496_1053833013300031713SoilIQRALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318493_1032898023300031723SoilNLFGVISFELFGQLHHVVGEEPGDRDAFFAGCVRRWIDLTALT
Ga0307468_10085420013300031740Hardwood Forest SoilVSFELFGQLHNVVAEPRAGRDAFFAECIRRWTTFITGLTVSS
Ga0318494_1005036843300031751SoilLMVWTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT
Ga0318554_1004125713300031765SoilWTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT
Ga0318526_1007723823300031769SoilTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG
Ga0318521_1023024613300031770SoilLMVWTNLFGVVSFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT
Ga0318521_1067937323300031770SoilTNLFGVVSFELFGQLHNVVAEDPADRDAFFAACVRHWISFTNLT
Ga0318529_1038397913300031792SoilVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG
Ga0318550_1036562123300031797SoilLVQRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG
Ga0318550_1047886613300031797SoilTGLFGVISFELYGQLHQVVGEEPADRDTFFAECIRRWLDFMNLG
Ga0318517_1021180523300031835SoilTNLFGVVAFEVFGQLHNVVGEDPADRDTFFAECVRRWITFTPIT
Ga0306923_1095442313300031910SoilQRALMVWTGLFGVISFELYGQLHQVVGEKPADRDTFFAECIRRWLDFMNLG
Ga0310910_1104640123300031946SoilTNLFGVVSFELFGQLHNVVEEDPADRDAFFADCIRRWITFTAMT
Ga0310909_1097898413300031947SoilFGVISFELYGQLHQVVGEKPADRDTFFAECIRRWLDFMNLG
Ga0318563_1063904023300032009SoilTWTGLFGVVSFELYGQLHQVVGELPTDRDAFFAECIRRWLAFMDLG
Ga0318559_1010492313300032039SoilMVWTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT
Ga0318549_1027599413300032041SoilTNLFGVISFELFGQLHSVVGEDPADRDAFFAECIRRWITFTAIT
Ga0318545_1005770613300032042SoilGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318575_1016794923300032055SoilIQRALMVWTGLFGVISFELYGQLHQVVGEEPADRDVFYAECIRRWLQFMDLG
Ga0318575_1037816013300032055SoilFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0318514_1003722743300032066SoilRALMVWTGLFGVISFELYGQLHQVVAEEPADRDTFFAECIRRWLDFMNLG
Ga0307472_10077145813300032205Hardwood Forest SoilLFGVISFELFGQLHNVVAEPPAGRDAFFAESIRRWLEFTAIS
Ga0335085_1022872943300032770SoilQRALMVWTNLFGVISFELFGQLHSVVGEDPADRDVFFAECIRYWITFTAIGRSPSSV
Ga0335085_1123547213300032770SoilELYGQLHNVVGEPSRDRGTFFAECIRHWIRFTGII
Ga0335077_1084186513300033158SoilPAVPAPLVQRALMVWTNLFGVISFELYGQLHNVVGEPSRDRGTFFAECIRHWIHLTGII


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.