Basic Information | |
---|---|
Family ID | F101664 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 41 residues |
Representative Sequence | QSRPPSELSDQLLSEIRLWQPASLAQQDDITLIVIDVV |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 1.96 % |
% of genes from short scaffolds (< 2000 bps) | 0.98 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.039 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.431 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.098 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.21% β-sheet: 0.00% Coil/Unstructured: 78.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF02585 | PIG-L | 1.96 |
PF02374 | ArsA_ATPase | 1.96 |
PF13180 | PDZ_2 | 1.96 |
PF00479 | G6PD_N | 1.96 |
PF12704 | MacB_PCD | 1.96 |
PF02632 | BioY | 1.96 |
PF00106 | adh_short | 0.98 |
PF03320 | FBPase_glpX | 0.98 |
PF00579 | tRNA-synt_1b | 0.98 |
PF00456 | Transketolase_N | 0.98 |
PF13847 | Methyltransf_31 | 0.98 |
PF01979 | Amidohydro_1 | 0.98 |
PF01734 | Patatin | 0.98 |
PF00232 | Glyco_hydro_1 | 0.98 |
PF00583 | Acetyltransf_1 | 0.98 |
PF01113 | DapB_N | 0.98 |
PF07228 | SpoIIE | 0.98 |
PF00107 | ADH_zinc_N | 0.98 |
PF01593 | Amino_oxidase | 0.98 |
PF00805 | Pentapeptide | 0.98 |
PF14060 | DUF4252 | 0.98 |
PF13701 | DDE_Tnp_1_4 | 0.98 |
PF03544 | TonB_C | 0.98 |
PF00665 | rve | 0.98 |
PF04191 | PEMT | 0.98 |
PF00392 | GntR | 0.98 |
PF08388 | GIIM | 0.98 |
PF14559 | TPR_19 | 0.98 |
PF05163 | DinB | 0.98 |
PF03476 | MOSC_N | 0.98 |
PF05694 | SBP56 | 0.98 |
PF00355 | Rieske | 0.98 |
PF00144 | Beta-lactamase | 0.98 |
PF02310 | B12-binding | 0.98 |
PF07676 | PD40 | 0.98 |
PF13424 | TPR_12 | 0.98 |
PF13649 | Methyltransf_25 | 0.98 |
PF00484 | Pro_CA | 0.98 |
PF00069 | Pkinase | 0.98 |
PF04095 | NAPRTase | 0.98 |
PF09603 | Fib_succ_major | 0.98 |
PF01855 | POR_N | 0.98 |
PF13378 | MR_MLE_C | 0.98 |
PF12867 | DinB_2 | 0.98 |
PF13237 | Fer4_10 | 0.98 |
PF03466 | LysR_substrate | 0.98 |
PF01814 | Hemerythrin | 0.98 |
PF13490 | zf-HC2 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.92 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 1.96 |
COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 1.96 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.96 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.98 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.98 |
COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.98 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.98 |
COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.98 |
COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 0.98 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.98 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.98 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.98 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.98 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.98 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.98 |
COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.98 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.98 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.98 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.98 |
COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.98 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.04 % |
All Organisms | root | All Organisms | 1.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300010048|Ga0126373_10051892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3647 | Open in IMG/M |
3300017966|Ga0187776_10424669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.96% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.98% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B3_GZOS_CLC_01902080 | 2124908035 | Soil | LEHVVRGSQSCSPSELSDRLLSEIRLWSPLSQQDDITLIVIDAV |
INPgaii200_06178251 | 2228664022 | Soil | SPSELPDELLSEIQIWQSASLAQQDDITLIVIDVV |
F14TC_1065059261 | 3300000559 | Soil | KLEQVVGNNQSRPPSELVDQLLSEIRRWQPASMAQQDDITLIVIDIV* |
Ga0070698_1022279812 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ENADGDSFGDSKFEQVVRDGQRSSPSDLSDRLLSEIHCWQPASLNQQDDITLIVIDAV* |
Ga0070735_107624641 | 3300005534 | Surface Soil | TPSELSEQLLSEIRLWQPARPGQQDDITLILIDVV* |
Ga0070684_1020681242 | 3300005535 | Corn Rhizosphere | GDSFGDKRLEDFVRCYQSCPPIEFSEKLLSELRQWQPASLSQQDDITLIVIDT* |
Ga0066692_104374731 | 3300005555 | Soil | RPPSELSDQLLSEIRIWQPALLDQQDDITLIVIDVV* |
Ga0075017_1000283214 | 3300006059 | Watersheds | MPGGSLSDDILSETRRWQPASATQQDDITLIVIDVL* |
Ga0075014_1009393121 | 3300006174 | Watersheds | DSFGDVKLEQVVRDGQRSSPSELSDQLLSAVRHWQPASITQQDDITLIVIDAV* |
Ga0070712_1002332281 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EFKFEQVVHNNQLRPPSELLDRLLTEIRHWQPASMAQHDDITLIAIDVL* |
Ga0079221_117153181 | 3300006804 | Agricultural Soil | KLEQVVRNNQSRPPSELSDQLLSEIRLWQPPSLAQQDDITLIVVDVV* |
Ga0075435_1000394591 | 3300007076 | Populus Rhizosphere | LKLEEVVRNNQSRPPSEMSDQLLSETRLWQPAGLGQQDDITLVVIDVV* |
Ga0115026_102633304 | 3300009111 | Wetland | SSSELVDQLLSQIRLWQPASSTQQDDITLIVVDVI* |
Ga0116221_10329651 | 3300009523 | Peatlands Soil | IRLEQVVRDNQGRPPSELSDRLLSEIRRWQPASISQQDDITLIVISP* |
Ga0116114_10478561 | 3300009630 | Peatland | INQSRPPAELSDQLLSEIRRWQPAATTQQDDITLVVIDVV* |
Ga0116126_12674641 | 3300009640 | Peatland | SRPPSELSEQLLAEIRQWQPASVTQQDDITLTIIDVV* |
Ga0116219_102294671 | 3300009824 | Peatlands Soil | KLEQVIRDNQSRPPSELLDQLLSEIRLWQPASLPQQDDITLIVIDVV* |
Ga0116223_105664601 | 3300009839 | Peatlands Soil | RDNQARSPSELSDELLAELRHWQPTSIAQQDDITLIVIDVV* |
Ga0126373_100518925 | 3300010048 | Tropical Forest Soil | QSCPPSELSDQLLSEIRLWQPASLAQQDDITLIVIDVV* |
Ga0126373_102482793 | 3300010048 | Tropical Forest Soil | APSELLDQLLGEIHRWQPASAAQHDDITVIVVDVV* |
Ga0126372_132473961 | 3300010360 | Tropical Forest Soil | QVVRNNQSRPASELLDQLMSEMRIWQPASLAQQDDITLIVIDVV* |
Ga0136449_1042252311 | 3300010379 | Peatlands Soil | NQSRPPSELCDQLLSEIRLWQPASLAQQDDITLIVVDVL* |
Ga0126383_129391001 | 3300010398 | Tropical Forest Soil | KLEEVVRNNQSGPPSELLDHLISEMSVWQPASLAQQDDITLIIIDVV* |
Ga0126375_119079471 | 3300012948 | Tropical Forest Soil | PPAELSEQMLSEMRAWQPPSLPQQDDITLVVIDVR* |
Ga0181539_11566561 | 3300014151 | Bog | DSFDDYKLEQVVRNNTSRSQSELVDQLLYEIRQWQPDSMVQQDDITLIVIDVV* |
Ga0181521_105456591 | 3300014158 | Bog | SRPPAELSEQLLSAIRHWQPASVTQQDDITLIIIDVV* |
Ga0182036_103977401 | 3300016270 | Soil | PPSELTDRLLNEIRVWQLPSMAQEDDITLIVIDVI |
Ga0182041_107964482 | 3300016294 | Soil | SRAPAELLDQLLAEIHRWQPASAAQHDDITLIVVDVV |
Ga0182035_119627541 | 3300016341 | Soil | TGDSFGDRKLEQVVRDNQSLPPSELSLSEIHVWQSASVAQQDDITLIVIDVV |
Ga0182040_110288152 | 3300016387 | Soil | PPSELLDQLLTEIRQWQPASKAQHDDITLIVIDVL |
Ga0182037_114233851 | 3300016404 | Soil | SAPGELLNQLLAEIHRWQPVSAAQQDDITLIVVDVV |
Ga0182039_100722901 | 3300016422 | Soil | KLEEVIRKNQSRPPAELLEQMLSEIRAWQPPSLPQQDDITLVVIDVR |
Ga0182039_117443561 | 3300016422 | Soil | RAPAELLDQLLAEIHRWQPASAAQHDDITLIVVDVV |
Ga0187801_102553341 | 3300017933 | Freshwater Sediment | GQRSSTSELSDRLLSAIRHWQPASITQQDDITLIVIDAV |
Ga0187801_104161561 | 3300017933 | Freshwater Sediment | VVRENQCCPSSELSDRLLSELRHWQPASTTQQDDITLIVIDVL |
Ga0187803_104458382 | 3300017934 | Freshwater Sediment | SFGDSKLEQVVRDGQRSSPSDLSDQLLSAVRHWQPASITQQDDITLIVIDAV |
Ga0187848_102816062 | 3300017935 | Peatland | RPPAELSEQLLSEVRHWQPASVTQQDDITLIIIDVV |
Ga0187848_103455092 | 3300017935 | Peatland | NNHSRPPSELAEQLLAEIRHWQPASVTQQDDITFIIIDVV |
Ga0187854_100509982 | 3300017938 | Peatland | EQVVRDNSLRPPSELSEQLLREIRLWQPASVTQQDDITLIVIDVV |
Ga0187775_100549541 | 3300017939 | Tropical Peatland | NNQSRPPSEMSDQLLSAIRLWRPAGLGQQDDITLIVIDVV |
Ga0187808_104991201 | 3300017942 | Freshwater Sediment | HPPSELSDRLLSELRHWQPASTTQQDDITLIVIDVL |
Ga0187819_100939131 | 3300017943 | Freshwater Sediment | RPPAELSEQLLSGIRQWRPASVPQQDDITLIIIDLV |
Ga0187779_107404532 | 3300017959 | Tropical Peatland | DSKLEQVVRKNRSCSPSELADQLISELRLWQPASAQQDDITLIIIDVF |
Ga0187776_104246693 | 3300017966 | Tropical Peatland | GDRKLEQVVRNNQSRQPSELSDQLLSEIRLWQPAPLVQQDDITLIVIDVV |
Ga0187782_101607201 | 3300017975 | Tropical Peatland | FGDFRLEQVVRDNHDRPASELSERLLSALQLWQPHSPSQQDDITLLVVDVV |
Ga0187876_11891742 | 3300018003 | Peatland | LEQVVRNNKSRPQSELVDQLLYEIRQWQPSSMVQQDDITLIVVDVV |
Ga0187804_103066931 | 3300018006 | Freshwater Sediment | QSRPPSELSDQLLSEIRLWQPASLAQQDDITLIVIDVV |
Ga0187804_104199061 | 3300018006 | Freshwater Sediment | GQRSSPSELSDQLLSAVRHWQPASITQQDDITLIVIDTV |
Ga0187884_103908192 | 3300018009 | Peatland | QSRPPSELSDQLLSEIRRWQPASITQQDDITLIIIDVA |
Ga0187810_102255312 | 3300018012 | Freshwater Sediment | VRNNQSRPSSELSDQLLFEIRLWQPASLAQQDDITLIVIDVL |
Ga0187810_103981542 | 3300018012 | Freshwater Sediment | PSSELSDRLLSELRHWQPASTTQQDDITLIVIDVL |
Ga0187873_12546461 | 3300018013 | Peatland | RLEQVVRHNQCRLSSELSDQLLSEIRHWQPAPVTQQDDITLIIIDVV |
Ga0187872_102247941 | 3300018017 | Peatland | PPSELSKQLLSEIRHWQPASMNQQDDITLIIIDVV |
Ga0187889_100532051 | 3300018023 | Peatland | RDNSLRPPSELSEQLLREIRLWQPASVTQQDDITLIVIDVV |
Ga0187766_112008491 | 3300018058 | Tropical Peatland | HQGRPAPELAELLLAELRAWQPAGVTQQDDITLIVIDVL |
Ga0187772_100786662 | 3300018085 | Tropical Peatland | VVRENQGRPPSALSDVLLAELRRWQPASTAQQDDITLIVIDVL |
Ga0187769_101736901 | 3300018086 | Tropical Peatland | RSHQSRSPSELSDQLLSEIRLWQPASLPQQDDITLIVIDVV |
Ga0187774_106856382 | 3300018089 | Tropical Peatland | DHKLEQVVRNNQPLPPSEFSTELLTEIRRWQPASMPQQDDITLIVIDVV |
Ga0210399_102285812 | 3300020581 | Soil | RDNQSRSPSELSEQLLSEIRVWQSASVAQQDDITLIVIDVV |
Ga0210399_110855841 | 3300020581 | Soil | VVRRNRSLAPSELSHKLLAEIRQWQPASVTQHDDITLIVIDVTI |
Ga0210404_102871763 | 3300021088 | Soil | SRPPSELSDQLLSEIRLWQPASLAQHDDITLIVIDVL |
Ga0187846_104353641 | 3300021476 | Biofilm | QICPASELIERLLAEVRAWQPAALAQQDDITLIVIDVT |
Ga0126371_119801801 | 3300021560 | Tropical Forest Soil | RPPSELSEQVLSEIRVWQSASVAQQDDITLIVIDVI |
Ga0126371_124302492 | 3300021560 | Tropical Forest Soil | EQVVRDNQSRPPSELSEQLLSEIRVWQSASVAQQDDITLIVIDVV |
Ga0207928_10016425 | 3300025494 | Arctic Peat Soil | SFGDLKLEQVVRGNQLCTASELSEHLLAEVRNWQPASMTQQDDITLLVIDVL |
Ga0208686_10010971 | 3300025500 | Peatland | EVVCKGHSLSSPEVSDRLLSELQHWQPASAPQQDDITLIVIDVL |
Ga0207671_103007504 | 3300025914 | Corn Rhizosphere | HSPAALSDRMLAEIRHWQPASLSQQDDITLIVIDVI |
Ga0207693_106802613 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DLKLEEVVRNNQSRPPSEMSDQLLSETRLWQPAGLGQQDDITLVVIDVV |
Ga0207679_114083453 | 3300025945 | Corn Rhizosphere | NQSRPPSELSDQLLSEISLWQPAALEQQDDITLIVIDVS |
Ga0207802_10112191 | 3300026847 | Tropical Forest Soil | RPPSELLDQLLTEIRHWQPASKAQHDDITLIVIDVL |
Ga0207815_10318031 | 3300027014 | Tropical Forest Soil | GPAELLDQLLAEIHRWQPASAAQHDDITLIVVDVI |
Ga0207806_10177173 | 3300027049 | Tropical Forest Soil | NQSRPPSELLDQLLTEIRHWQPASKAQHDDITLIVIDVL |
Ga0209214_10619452 | 3300027071 | Forest Soil | KNQSRPPGELLEQMLWEIRAWQPASLPQQDDITLVLIDVR |
Ga0209635_111049421 | 3300027888 | Marine Sediment | EQVIRKNQSCPPSELVDLLLSEIRLWQPASNEQQDDITLVIVDVI |
Ga0209698_1000878610 | 3300027911 | Watersheds | MPGGSLSDDILSETRRWQPASATQQDDITLIVIDVL |
Ga0209526_102168152 | 3300028047 | Forest Soil | DRKLEQVVRNNQSRPPSELSDQLLSEIRLWQPASLAQQDDITLIVIDVV |
Ga0311350_109157611 | 3300030002 | Fen | KTPAELSDALLREIDHWRPASAPQQDDITLVVVDVV |
Ga0311349_121745691 | 3300030294 | Fen | NQSRTPAELAHDLLREIDHWRPASVPQQDDITLVVIDVA |
Ga0170823_127034111 | 3300031128 | Forest Soil | PPSELLDRLLTEIRHWQPASMAQHDDITLIAIDVL |
Ga0318541_100229871 | 3300031545 | Soil | SLPSELSKQLLSEIRVWQSASVAQQDDITLIVIDVL |
Ga0310915_100190121 | 3300031573 | Soil | SRPPAELLEQMLSEIRAWQPPSLPQQDDITLVVIDVR |
Ga0318561_100526931 | 3300031679 | Soil | AVLRDVQSRPPSEVSTCLLREIGSWQPSQTSQQDDITLIVIDVV |
Ga0307475_104493702 | 3300031754 | Hardwood Forest Soil | RAPSELLDQLLSEIRQWQPASMAQRDDITLIAIDIL |
Ga0318537_103382171 | 3300031763 | Soil | LEAVLRDVQSRPPSEVSTCLLREIGSWQPSQTSQQDDITLIVIDVV |
Ga0307473_102446382 | 3300031820 | Hardwood Forest Soil | KFEQVVRNNQLRPPSELLDRLLTEIRHWQPASMAQHDDITLIAIDVL |
Ga0318567_104212932 | 3300031821 | Soil | ARQPSEFIEQLLSEIRLWQPRTAAQHDDITLIVIDVI |
Ga0310913_106051662 | 3300031945 | Soil | APAELLDQLLAEIHRWQPASAAQHDDITLIVVDVV |
Ga0306926_104941492 | 3300031954 | Soil | EQVVRDNGSHAPAELLDQLLAEIHRWQPVSAAQQDDITLIVVDVV |
Ga0307479_109357141 | 3300031962 | Hardwood Forest Soil | DIRLEQSVRDNQLRPASELLERLLFEIHHWQPASITQQDDITLIVIDVG |
Ga0310911_109354671 | 3300032035 | Soil | NQSRPPAELLEQMLSEIRAWQPPSLPQQDDITLVVIDVR |
Ga0318506_102066481 | 3300032052 | Soil | NQSRPPSELLDQLLTEIRQWQPASKAQHDDITLIAIDII |
Ga0311301_100724467 | 3300032160 | Peatlands Soil | RPPSELLDQLLSEIRLWQPASLPQQDDITLIVIDVV |
Ga0311301_104866683 | 3300032160 | Peatlands Soil | FGDIALEQSVRDNQFRPASELSERLLSELHRWKPDSITQQDDITLIVIDVG |
Ga0335069_113797061 | 3300032893 | Soil | EVIRNNESRPSAELLEQMLTEIRAWQPGSLPPQQDDITLVVIDVG |
Ga0335074_114684072 | 3300032895 | Soil | ESQLLPSSELSDRLLSELRHWQPASPAQQDDITLIVIDVL |
Ga0335073_102315981 | 3300033134 | Soil | QSRPSSELLSQLLAEIHAWQPATLPQQDDITLLAIDVS |
Ga0310914_106006913 | 3300033289 | Soil | QSRPASELLDQLLTEIRQWQPASMAQHDDITLIVIDVV |
Ga0326728_107419431 | 3300033402 | Peat Soil | PPSELSEQLLSEIHHWQPAFVTQQDDITLIIIDVV |
Ga0326727_105801531 | 3300033405 | Peat Soil | VRNNHSRPPSELSEQLLSEIHHWQPAFVTQQDDITLIIIDVV |
Ga0310810_112496851 | 3300033412 | Soil | QGRPPSELPGQLLTEIEAWQPASLAQQDDITLLVIDVV |
Ga0371488_0079262_1744_1887 | 3300033983 | Peat Soil | QLEKIVRNNRSRLPAELSEELLSGIRHWRPASVPQQDDITLIVIDVV |
Ga0370484_0212528_385_531 | 3300034125 | Untreated Peat Soil | KRLENVLRGSQVYSPAELSDRMLAEIRQWQPASNSQQDDITLIIIDAV |
⦗Top⦘ |