Basic Information | |
---|---|
Family ID | F101772 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 45 residues |
Representative Sequence | MLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 6.86 % |
% of genes from short scaffolds (< 2000 bps) | 6.86 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (95.098 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.823 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.137 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 18.31% Coil/Unstructured: 77.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF07995 | GSDH | 18.63 |
PF03631 | Virul_fac_BrkB | 8.82 |
PF07883 | Cupin_2 | 3.92 |
PF03972 | MmgE_PrpD | 2.94 |
PF04909 | Amidohydro_2 | 2.94 |
PF01370 | Epimerase | 2.94 |
PF09084 | NMT1 | 1.96 |
PF01904 | DUF72 | 1.96 |
PF02371 | Transposase_20 | 1.96 |
PF13340 | DUF4096 | 0.98 |
PF07690 | MFS_1 | 0.98 |
PF00472 | RF-1 | 0.98 |
PF07969 | Amidohydro_3 | 0.98 |
PF00701 | DHDPS | 0.98 |
PF04542 | Sigma70_r2 | 0.98 |
PF00561 | Abhydrolase_1 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 18.63 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 8.82 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 2.94 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.96 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.96 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.96 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.96 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.98 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.98 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.98 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 95.10 % |
All Organisms | root | All Organisms | 4.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886013|SwBSRL2_contig_5952744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1007 | Open in IMG/M |
3300012200|Ga0137382_10763796 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012210|Ga0137378_11013557 | Not Available | 744 | Open in IMG/M |
3300014871|Ga0180095_1068756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
3300021081|Ga0210379_10424590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
3300025537|Ga0210061_1052576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300025905|Ga0207685_10534930 | Not Available | 621 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.86% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.94% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.98% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.98% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.98% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwBSRL2_0208.00005690 | 2162886013 | Switchgrass Rhizosphere | KDPKGVLRKDNGMLEVDTFHGHINVDELKIGPENMPSSMNGRGLIRDENGNLVFA |
INPhiseqgaiiFebDRAFT_1011920052 | 3300000364 | Soil | TFHGHVKVSELKIGPENMPASTEGRGLIRDKNGKLVFV* |
F14TC_1015401302 | 3300000559 | Soil | FHGHVKVNELKIGPENMPSSRDGQGLIRDKEGKLVFGEPS* |
AF_2010_repII_A001DRAFT_100988291 | 3300000793 | Forest Soil | PKEMLEVDTFHGHIKVKDLKIRSENMPSSTEGRGLIRDKNGNLVFA* |
AP72_2010_repI_A100DRAFT_10029241 | 3300000837 | Forest Soil | PKGVDRRPKEMLEVDTFHGHVKVKDLKICSENMPSSTQGGGLIRDKNGNLVFA* |
JGI24808J26613_10567681 | 3300002099 | Soil | DRRQKGMLEVDTFHGHVKVSELKIGPENMPSSMDGKGLIRDRNGNLVFA* |
Ga0055465_103039952 | 3300004013 | Natural And Restored Wetlands | VFRQDKEMLEVDTYHGHVKVGDLKIGPENMPSSMGGRGLIRDHDGNLVFA* |
Ga0066395_100899161 | 3300004633 | Tropical Forest Soil | DRRPKEMLEVDTFHGHVKVKDFKISSENMPSSTEGRGLIRDKNGNLVFA* |
Ga0065705_100715002 | 3300005294 | Switchgrass Rhizosphere | DTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0065707_105647522 | 3300005295 | Switchgrass Rhizosphere | DTFHGHVRISELKIGPENMTASTEGRGLIRDQDGKLVFA* |
Ga0070677_101524932 | 3300005333 | Miscanthus Rhizosphere | KGVSRQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0068869_1011684502 | 3300005334 | Miscanthus Rhizosphere | KGVAREANGMLEVDTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA* |
Ga0070682_1017867922 | 3300005337 | Corn Rhizosphere | GVVRQENGMLEVDTFHGHVRASELKVGPENMPSSTEGRGLIRDKHGNLVFA* |
Ga0070689_1005564301 | 3300005340 | Switchgrass Rhizosphere | PKGVAREANGMLEVDTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA* |
Ga0070703_104011452 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | REANGMLEVDTFHGHVKVSELKISPENMPSSTDGRGLIRDKNGALVFA* |
Ga0070709_113438691 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0070684_1005450602 | 3300005535 | Corn Rhizosphere | EVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0070664_1004803892 | 3300005564 | Corn Rhizosphere | QENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDNSGNLVFA* |
Ga0068857_1024647641 | 3300005577 | Corn Rhizosphere | QENGMLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA* |
Ga0068859_1009301782 | 3300005617 | Switchgrass Rhizosphere | TFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0066903_1015621681 | 3300005764 | Tropical Forest Soil | TFHGHVKVKDLKISSENMPSSTEGRGLIRDKNGNLVFA* |
Ga0066903_1027444592 | 3300005764 | Tropical Forest Soil | EADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA* |
Ga0074470_118195113 | 3300005836 | Sediment (Intertidal) | GHIPVNELKIGPDNMPSSRDGAGLIRDKNGDLVFT* |
Ga0070716_1000819913 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EMLEVDTFHGHIKVKDLRISSENMPASTEGKGLIRDKNGNLVFA* |
Ga0079220_113661621 | 3300006806 | Agricultural Soil | VDRVPKEMLEVDTFHGHIKASELRIGPENLPSSTNGRGLIRDRNGKLVFA* |
Ga0075430_1011308382 | 3300006846 | Populus Rhizosphere | DTFHGHVKVSELKIGPENMPSSTDGKGLIRDRNGNLVFA* |
Ga0075433_107109991 | 3300006852 | Populus Rhizosphere | RQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA* |
Ga0075436_1008754552 | 3300006914 | Populus Rhizosphere | MLEVDTFHGHVRASELKIGPENMPSSTEGRGLIRDKHGNLVFA* |
Ga0079303_102326603 | 3300006930 | Deep Subsurface | RPMLEVDTFHGHVHVNELKIGPDNMPSSRNGGGLIRDKDGKLVFA* |
Ga0066710_1040140662 | 3300009012 | Grasslands Soil | DTFHGHVKVSELKIGPENMSSSTEGRGLIRDQKGNLVFA |
Ga0105106_102947051 | 3300009078 | Freshwater Sediment | ANGMLEVDTFHGHVRVSDLKIGPENMPSSTEGRGLIRDKNGDLVFA* |
Ga0066709_1044136572 | 3300009137 | Grasslands Soil | VDRRQNGMLEVDTFHGHVKVNELKIGPENMLSSTEGRGLIRDQNGNLVFA* |
Ga0114129_131012511 | 3300009147 | Populus Rhizosphere | MLEVDTFHGHVTLDELKIGPENMPSSRDGGGLIRDKHGKLVFA* |
Ga0111538_123858311 | 3300009156 | Populus Rhizosphere | VDTFHGHVKANDLKIGPENMPSSINGGGLIRDKNGNLVFA* |
Ga0105092_100536093 | 3300009157 | Freshwater Sediment | EVDTFHGHVKVSELRIGPENMPASTEGRGLIRDQNGKLVFGG* |
Ga0075423_108851183 | 3300009162 | Populus Rhizosphere | AMVEVDTFHGHVNVSDLKIGPQNMPSSRDGRGLIRDKDGRLIFT* |
Ga0075423_127466501 | 3300009162 | Populus Rhizosphere | MLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA* |
Ga0105101_105496971 | 3300009171 | Freshwater Sediment | VDTFHGHVHVNELKIGPENMPSSRGGAGLIRDNDGKLVFA* |
Ga0114945_107569822 | 3300009444 | Thermal Springs | VDTFHGHIKASELEIGPKNLPSSRDGGGFIRDKEGKLVFE* |
Ga0126307_105577803 | 3300009789 | Serpentine Soil | FHGHVHVDELKIGVDNMPSSRNGAGLIRDSAGRLVFR* |
Ga0126374_100081485 | 3300009792 | Tropical Forest Soil | DTFHGHVKVKDLKISSENMPSSTEGRGLIRDKNGNLVFA* |
Ga0105061_10037741 | 3300009807 | Groundwater Sand | DRRQKGMLEVDTFHGHIKVSELKIGPENMPLSTEGRGLIRDQNGKLVFGG* |
Ga0105076_11020321 | 3300009816 | Groundwater Sand | HVKVSELKIGPENMPASTAGRGLIRDQNGKLVFA* |
Ga0126384_106069522 | 3300010046 | Tropical Forest Soil | DRRQNGMLEVDTFHGHVKVSELKIGPENMPSSGGGGGLIRDQNGKLVFG* |
Ga0126382_121631871 | 3300010047 | Tropical Forest Soil | PKGVVRRQNGMLEVDTFHGHVKVGELKIGPENMPSSAGGGGLIRDQNGKLVFG* |
Ga0127503_103196902 | 3300010154 | Soil | DTFHGHVKVSELKIGPENMPSSMDGRGLIRDQNGNLVFT* |
Ga0134071_105596702 | 3300010336 | Grasslands Soil | VDRKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKQGKLVFGE |
Ga0134062_102392551 | 3300010337 | Grasslands Soil | MLEVDTFHGHVRLNELKIGSENMPASTEGRGLIRDQNGNLVFASG* |
Ga0126377_120579032 | 3300010362 | Tropical Forest Soil | QNGMLEVDTFHGHVKVSELKIGPENMPSSAGGGGLIRNQDGKLVFG* |
Ga0126381_1050754831 | 3300010376 | Tropical Forest Soil | EPDTFKGLVTVDELKVGPDNMPSSRDGRGLLRDASGKLLFA* |
Ga0137312_10775981 | 3300011400 | Soil | GAERQAKAMVEVDTFHGHVKVNELKIGPQNMPSSRDGRGLIRDKDGRLVFA* |
Ga0137382_107637961 | 3300012200 | Vadose Zone Soil | KDPKGVDRRQKGMLEVDTFHGHVKVSELKIGPENMSSSTEGRGLIRDQKGNLVFA* |
Ga0137378_110135571 | 3300012210 | Vadose Zone Soil | PKGVERKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKEGKLVFGEPS* |
Ga0137369_107234181 | 3300012355 | Vadose Zone Soil | RKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKQGNLVFGAPS* |
Ga0137385_113597791 | 3300012359 | Vadose Zone Soil | DTFHGHVKINELKIGPKNMLSSTEGRGLIRDQNGNLVFA* |
Ga0137375_102258681 | 3300012360 | Vadose Zone Soil | GMLEVDTFHGHVKAHELKIGPENMASSRDGQGLIRDKEGRLVFA* |
Ga0157331_10105802 | 3300012486 | Soil | VRQENGMLEVDTFHGHVRASELKVGPENMPSSSEGRGLIRDKHGNLVFA* |
Ga0153915_107338631 | 3300012931 | Freshwater Wetlands | VDTFHGHVKFSELKIGPENMPPSTDGRGLIRDQNGELVFA* |
Ga0137410_114785121 | 3300012944 | Vadose Zone Soil | MLEVDTFHGHVKASELKIGPENMPSSTDGVGLIRDQKGNLVFA* |
Ga0164303_105354351 | 3300012957 | Soil | IDRRQNGMLEVDTFHGHVKVSELKIGPENMPASTEGRGLIRDKNGKLVFA* |
Ga0134081_100158651 | 3300014150 | Grasslands Soil | PKGVDRQQKGMLEVDTFHGHVRLNELKIGPENMPASTEGRGLIRDQNGNLVFAS* |
Ga0157380_130755191 | 3300014326 | Switchgrass Rhizosphere | ANGMLEVDTFHGHVKVSELRISPENMPSSTDGRGLIRDKNGELVFA* |
Ga0180095_10687562 | 3300014871 | Soil | HREARAMLEVDTFHGHLHVNDLKIGPENLPTSRHGAGLIRDQDGKLVFA* |
Ga0132256_1014381561 | 3300015372 | Arabidopsis Rhizosphere | KGVVRQENGMLEVDTFHGHIKASELKIGPENMPSSTEGRGLIRDKRGNLVFA* |
Ga0132256_1023179352 | 3300015372 | Arabidopsis Rhizosphere | GMLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA* |
Ga0132255_1016089871 | 3300015374 | Arabidopsis Rhizosphere | VDTFHGHVKASELKIGPENMPSSTDGRGLIRDKNGDLVFA* |
Ga0132255_1052623202 | 3300015374 | Arabidopsis Rhizosphere | EVDTFHGHIRASELKIGPENMPSSTEGRGLIRDKHGNLVFA* |
Ga0182041_108805452 | 3300016294 | Soil | EIDTYKGFAKLSELKIGPENMPDSRDGRGLIRDREGKLVFA |
Ga0184634_104568711 | 3300018031 | Groundwater Sediment | KGAFRQVKEMLEVDTYHGHVKVSELKIGPENMPSSTGGRGLIRDKEGNLVFA |
Ga0184637_102724633 | 3300018063 | Groundwater Sediment | TFHGHVKISELKIAPENMPSSTDGGGLIRDKDGNLVFA |
Ga0184629_101027111 | 3300018084 | Groundwater Sediment | MLEVDTFHGHLHVNDLKIGPENLPTSRHGAGLIRDQDGKLVFA |
Ga0190265_110655041 | 3300018422 | Soil | TFHGHVKASEIRIGPENMPSSAGGRGLIRDKDGALVFA |
Ga0190265_133578491 | 3300018422 | Soil | GHVRIDELKIGPENMPSSIDGGGLIRDSRGNLVFE |
Ga0190265_133654431 | 3300018422 | Soil | GHVKVSELKISAENMPSSTDGRGLIRDKNGELVFA |
Ga0193743_10521181 | 3300019889 | Soil | FHGHVKVSELKISPENMPSSTDGRGLIRDKNGELVFA |
Ga0193721_10406432 | 3300020018 | Soil | MLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA |
Ga0193726_13809932 | 3300020021 | Soil | KGAAREANGMLEVDTFHGHVKVSELKISPENMPSSTDGRGLIRDKNGELVFA |
Ga0210379_104245902 | 3300021081 | Groundwater Sediment | PKGVFRQVKEILEVDTYHGHVKVSDLKIGPENMPASTEGRGLIRDNDGNLVFA |
Ga0210061_10525762 | 3300025537 | Natural And Restored Wetlands | DPKGVIREDNGMLEVDTFHGHVHINELRIGPENMPSSADGRGLIRDSQGNLVFA |
Ga0207685_105349302 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RDPKGVSRGANGMLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA |
Ga0207660_102581782 | 3300025917 | Corn Rhizosphere | LEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA |
Ga0207652_100616711 | 3300025921 | Corn Rhizosphere | NGMLEVDTFHGHIRASELKIGPENMPSSIDGGGLIRNKNGELVFG |
Ga0207701_100253777 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA |
Ga0207651_121366701 | 3300025960 | Switchgrass Rhizosphere | DTFHGHVRASELKIGPENMPSSTEGRGLIRDKHGNLVFA |
Ga0207677_120120302 | 3300026023 | Miscanthus Rhizosphere | FHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA |
Ga0207676_115191591 | 3300026095 | Switchgrass Rhizosphere | DTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA |
Ga0209875_10013561 | 3300027209 | Groundwater Sand | VDTFHGHVKVSELKIGPENMPSSTGGRGLIRDQNGKLVFAG |
Ga0209982_10178893 | 3300027552 | Arabidopsis Thaliana Rhizosphere | KENGMLEVDTFHGHVRVDELKIGPENMPPSTDGRGLIRDQNGNLVFE |
Ga0209465_100249191 | 3300027874 | Tropical Forest Soil | KGVDRRPKEMLEVDTFHGHVKVKDFKISSENMPSSTEGRGLIRDKNGNLVFA |
Ga0209705_106101041 | 3300027979 | Freshwater Sediment | VDTFHGHVRVNELKIGPENMPSSRGGAGLIRDKDGKLVFA |
Ga0302046_103661602 | 3300030620 | Soil | EVDTFHGHININELKIGPENMPSSADGRGLIRDSQGNLVFA |
(restricted) Ga0255312_10884822 | 3300031248 | Sandy Soil | EVDTFHGHIKVDELKIGPENMPSSREGRGLIRDQKGNLVFA |
Ga0310915_101828981 | 3300031573 | Soil | QGVIEADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA |
Ga0318546_104317171 | 3300031771 | Soil | TFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA |
Ga0307473_111868842 | 3300031820 | Hardwood Forest Soil | GVSRGANGMLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA |
Ga0318544_102980762 | 3300031880 | Soil | IEADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA |
Ga0310912_109198081 | 3300031941 | Soil | LEVDTFHGHVKVSELKIGPENMPSSTEGRGLIRDKNGNLVFS |
Ga0306926_103820903 | 3300031954 | Soil | SGMLEVDTFHGHVNFNELKIGAENMPASTEGRGLIRDKNGKLVFA |
Ga0335085_105236791 | 3300032770 | Soil | ERQAREMLEVDTFHGHVRVGELKIGPENMPSSTNGRGLLRDKDGNLVFA |
Ga0335077_114724671 | 3300033158 | Soil | PPKAVVTNNQGIVEVDTFKGLIKASEIVLGPENMPSSKDGHGLIRDRNSQLVFA |
Ga0316619_111562451 | 3300033414 | Soil | GHVHVNELKIGPDNMPSSRNGAGLIRDKAGKLVFA |
Ga0364945_0005100_11_142 | 3300034115 | Sediment | MLEVDTFHGHVKINELKIGPENMPSSTNGRGLIRDQNGNLVFA |
⦗Top⦘ |