NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101772

Metagenome / Metatranscriptome Family F101772

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101772
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence MLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA
Number of Associated Samples 96
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 6.86 %
% of genes from short scaffolds (< 2000 bps) 6.86 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (95.098 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.823 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.137 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.23%    β-sheet: 18.31%    Coil/Unstructured: 77.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF07995GSDH 18.63
PF03631Virul_fac_BrkB 8.82
PF07883Cupin_2 3.92
PF03972MmgE_PrpD 2.94
PF04909Amidohydro_2 2.94
PF01370Epimerase 2.94
PF09084NMT1 1.96
PF01904DUF72 1.96
PF02371Transposase_20 1.96
PF13340DUF4096 0.98
PF07690MFS_1 0.98
PF00472RF-1 0.98
PF07969Amidohydro_3 0.98
PF00701DHDPS 0.98
PF04542Sigma70_r2 0.98
PF00561Abhydrolase_1 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 18.63
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 8.82
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 2.94
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.96
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.96
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 1.96
COG3547TransposaseMobilome: prophages, transposons [X] 1.96
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.96
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.98
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.98
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.98
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.98
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.98
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A95.10 %
All OrganismsrootAll Organisms4.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_5952744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1007Open in IMG/M
3300012200|Ga0137382_10763796All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012210|Ga0137378_11013557Not Available744Open in IMG/M
3300014871|Ga0180095_1068756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300021081|Ga0210379_10424590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300025537|Ga0210061_1052576All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300025905|Ga0207685_10534930Not Available621Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.98%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.98%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.98%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.98%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0208.000056902162886013Switchgrass RhizosphereKDPKGVLRKDNGMLEVDTFHGHINVDELKIGPENMPSSMNGRGLIRDENGNLVFA
INPhiseqgaiiFebDRAFT_10119200523300000364SoilTFHGHVKVSELKIGPENMPASTEGRGLIRDKNGKLVFV*
F14TC_10154013023300000559SoilFHGHVKVNELKIGPENMPSSRDGQGLIRDKEGKLVFGEPS*
AF_2010_repII_A001DRAFT_1009882913300000793Forest SoilPKEMLEVDTFHGHIKVKDLKIRSENMPSSTEGRGLIRDKNGNLVFA*
AP72_2010_repI_A100DRAFT_100292413300000837Forest SoilPKGVDRRPKEMLEVDTFHGHVKVKDLKICSENMPSSTQGGGLIRDKNGNLVFA*
JGI24808J26613_105676813300002099SoilDRRQKGMLEVDTFHGHVKVSELKIGPENMPSSMDGKGLIRDRNGNLVFA*
Ga0055465_1030399523300004013Natural And Restored WetlandsVFRQDKEMLEVDTYHGHVKVGDLKIGPENMPSSMGGRGLIRDHDGNLVFA*
Ga0066395_1008991613300004633Tropical Forest SoilDRRPKEMLEVDTFHGHVKVKDFKISSENMPSSTEGRGLIRDKNGNLVFA*
Ga0065705_1007150023300005294Switchgrass RhizosphereDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0065707_1056475223300005295Switchgrass RhizosphereDTFHGHVRISELKIGPENMTASTEGRGLIRDQDGKLVFA*
Ga0070677_1015249323300005333Miscanthus RhizosphereKGVSRQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0068869_10116845023300005334Miscanthus RhizosphereKGVAREANGMLEVDTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA*
Ga0070682_10178679223300005337Corn RhizosphereGVVRQENGMLEVDTFHGHVRASELKVGPENMPSSTEGRGLIRDKHGNLVFA*
Ga0070689_10055643013300005340Switchgrass RhizospherePKGVAREANGMLEVDTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA*
Ga0070703_1040114523300005406Corn, Switchgrass And Miscanthus RhizosphereREANGMLEVDTFHGHVKVSELKISPENMPSSTDGRGLIRDKNGALVFA*
Ga0070709_1134386913300005434Corn, Switchgrass And Miscanthus RhizosphereVSRQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0070684_10054506023300005535Corn RhizosphereEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0070664_10048038923300005564Corn RhizosphereQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDNSGNLVFA*
Ga0068857_10246476413300005577Corn RhizosphereQENGMLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA*
Ga0068859_10093017823300005617Switchgrass RhizosphereTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0066903_10156216813300005764Tropical Forest SoilTFHGHVKVKDLKISSENMPSSTEGRGLIRDKNGNLVFA*
Ga0066903_10274445923300005764Tropical Forest SoilEADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA*
Ga0074470_1181951133300005836Sediment (Intertidal)GHIPVNELKIGPDNMPSSRDGAGLIRDKNGDLVFT*
Ga0070716_10008199133300006173Corn, Switchgrass And Miscanthus RhizosphereEMLEVDTFHGHIKVKDLRISSENMPASTEGKGLIRDKNGNLVFA*
Ga0079220_1136616213300006806Agricultural SoilVDRVPKEMLEVDTFHGHIKASELRIGPENLPSSTNGRGLIRDRNGKLVFA*
Ga0075430_10113083823300006846Populus RhizosphereDTFHGHVKVSELKIGPENMPSSTDGKGLIRDRNGNLVFA*
Ga0075433_1071099913300006852Populus RhizosphereRQENGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA*
Ga0075436_10087545523300006914Populus RhizosphereMLEVDTFHGHVRASELKIGPENMPSSTEGRGLIRDKHGNLVFA*
Ga0079303_1023266033300006930Deep SubsurfaceRPMLEVDTFHGHVHVNELKIGPDNMPSSRNGGGLIRDKDGKLVFA*
Ga0066710_10401406623300009012Grasslands SoilDTFHGHVKVSELKIGPENMSSSTEGRGLIRDQKGNLVFA
Ga0105106_1029470513300009078Freshwater SedimentANGMLEVDTFHGHVRVSDLKIGPENMPSSTEGRGLIRDKNGDLVFA*
Ga0066709_10441365723300009137Grasslands SoilVDRRQNGMLEVDTFHGHVKVNELKIGPENMLSSTEGRGLIRDQNGNLVFA*
Ga0114129_1310125113300009147Populus RhizosphereMLEVDTFHGHVTLDELKIGPENMPSSRDGGGLIRDKHGKLVFA*
Ga0111538_1238583113300009156Populus RhizosphereVDTFHGHVKANDLKIGPENMPSSINGGGLIRDKNGNLVFA*
Ga0105092_1005360933300009157Freshwater SedimentEVDTFHGHVKVSELRIGPENMPASTEGRGLIRDQNGKLVFGG*
Ga0075423_1088511833300009162Populus RhizosphereAMVEVDTFHGHVNVSDLKIGPQNMPSSRDGRGLIRDKDGRLIFT*
Ga0075423_1274665013300009162Populus RhizosphereMLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA*
Ga0105101_1054969713300009171Freshwater SedimentVDTFHGHVHVNELKIGPENMPSSRGGAGLIRDNDGKLVFA*
Ga0114945_1075698223300009444Thermal SpringsVDTFHGHIKASELEIGPKNLPSSRDGGGFIRDKEGKLVFE*
Ga0126307_1055778033300009789Serpentine SoilFHGHVHVDELKIGVDNMPSSRNGAGLIRDSAGRLVFR*
Ga0126374_1000814853300009792Tropical Forest SoilDTFHGHVKVKDLKISSENMPSSTEGRGLIRDKNGNLVFA*
Ga0105061_100377413300009807Groundwater SandDRRQKGMLEVDTFHGHIKVSELKIGPENMPLSTEGRGLIRDQNGKLVFGG*
Ga0105076_110203213300009816Groundwater SandHVKVSELKIGPENMPASTAGRGLIRDQNGKLVFA*
Ga0126384_1060695223300010046Tropical Forest SoilDRRQNGMLEVDTFHGHVKVSELKIGPENMPSSGGGGGLIRDQNGKLVFG*
Ga0126382_1216318713300010047Tropical Forest SoilPKGVVRRQNGMLEVDTFHGHVKVGELKIGPENMPSSAGGGGLIRDQNGKLVFG*
Ga0127503_1031969023300010154SoilDTFHGHVKVSELKIGPENMPSSMDGRGLIRDQNGNLVFT*
Ga0134071_1055967023300010336Grasslands SoilVDRKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKQGKLVFGE
Ga0134062_1023925513300010337Grasslands SoilMLEVDTFHGHVRLNELKIGSENMPASTEGRGLIRDQNGNLVFASG*
Ga0126377_1205790323300010362Tropical Forest SoilQNGMLEVDTFHGHVKVSELKIGPENMPSSAGGGGLIRNQDGKLVFG*
Ga0126381_10507548313300010376Tropical Forest SoilEPDTFKGLVTVDELKVGPDNMPSSRDGRGLLRDASGKLLFA*
Ga0137312_107759813300011400SoilGAERQAKAMVEVDTFHGHVKVNELKIGPQNMPSSRDGRGLIRDKDGRLVFA*
Ga0137382_1076379613300012200Vadose Zone SoilKDPKGVDRRQKGMLEVDTFHGHVKVSELKIGPENMSSSTEGRGLIRDQKGNLVFA*
Ga0137378_1101355713300012210Vadose Zone SoilPKGVERKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKEGKLVFGEPS*
Ga0137369_1072341813300012355Vadose Zone SoilRKQNGMLEVDTFHGHVKVNELKIGPENMPSSRDGQGLIRDKQGNLVFGAPS*
Ga0137385_1135977913300012359Vadose Zone SoilDTFHGHVKINELKIGPKNMLSSTEGRGLIRDQNGNLVFA*
Ga0137375_1022586813300012360Vadose Zone SoilGMLEVDTFHGHVKAHELKIGPENMASSRDGQGLIRDKEGRLVFA*
Ga0157331_101058023300012486SoilVRQENGMLEVDTFHGHVRASELKVGPENMPSSSEGRGLIRDKHGNLVFA*
Ga0153915_1073386313300012931Freshwater WetlandsVDTFHGHVKFSELKIGPENMPPSTDGRGLIRDQNGELVFA*
Ga0137410_1147851213300012944Vadose Zone SoilMLEVDTFHGHVKASELKIGPENMPSSTDGVGLIRDQKGNLVFA*
Ga0164303_1053543513300012957SoilIDRRQNGMLEVDTFHGHVKVSELKIGPENMPASTEGRGLIRDKNGKLVFA*
Ga0134081_1001586513300014150Grasslands SoilPKGVDRQQKGMLEVDTFHGHVRLNELKIGPENMPASTEGRGLIRDQNGNLVFAS*
Ga0157380_1307551913300014326Switchgrass RhizosphereANGMLEVDTFHGHVKVSELRISPENMPSSTDGRGLIRDKNGELVFA*
Ga0180095_106875623300014871SoilHREARAMLEVDTFHGHLHVNDLKIGPENLPTSRHGAGLIRDQDGKLVFA*
Ga0132256_10143815613300015372Arabidopsis RhizosphereKGVVRQENGMLEVDTFHGHIKASELKIGPENMPSSTEGRGLIRDKRGNLVFA*
Ga0132256_10231793523300015372Arabidopsis RhizosphereGMLEVDTFHGHVRASELKIGPENMPSSSEGRGLIRDKHGNLVFA*
Ga0132255_10160898713300015374Arabidopsis RhizosphereVDTFHGHVKASELKIGPENMPSSTDGRGLIRDKNGDLVFA*
Ga0132255_10526232023300015374Arabidopsis RhizosphereEVDTFHGHIRASELKIGPENMPSSTEGRGLIRDKHGNLVFA*
Ga0182041_1088054523300016294SoilEIDTYKGFAKLSELKIGPENMPDSRDGRGLIRDREGKLVFA
Ga0184634_1045687113300018031Groundwater SedimentKGAFRQVKEMLEVDTYHGHVKVSELKIGPENMPSSTGGRGLIRDKEGNLVFA
Ga0184637_1027246333300018063Groundwater SedimentTFHGHVKISELKIAPENMPSSTDGGGLIRDKDGNLVFA
Ga0184629_1010271113300018084Groundwater SedimentMLEVDTFHGHLHVNDLKIGPENLPTSRHGAGLIRDQDGKLVFA
Ga0190265_1106550413300018422SoilTFHGHVKASEIRIGPENMPSSAGGRGLIRDKDGALVFA
Ga0190265_1335784913300018422SoilGHVRIDELKIGPENMPSSIDGGGLIRDSRGNLVFE
Ga0190265_1336544313300018422SoilGHVKVSELKISAENMPSSTDGRGLIRDKNGELVFA
Ga0193743_105211813300019889SoilFHGHVKVSELKISPENMPSSTDGRGLIRDKNGELVFA
Ga0193721_104064323300020018SoilMLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA
Ga0193726_138099323300020021SoilKGAAREANGMLEVDTFHGHVKVSELKISPENMPSSTDGRGLIRDKNGELVFA
Ga0210379_1042459023300021081Groundwater SedimentPKGVFRQVKEILEVDTYHGHVKVSDLKIGPENMPASTEGRGLIRDNDGNLVFA
Ga0210061_105257623300025537Natural And Restored WetlandsDPKGVIREDNGMLEVDTFHGHVHINELRIGPENMPSSADGRGLIRDSQGNLVFA
Ga0207685_1053493023300025905Corn, Switchgrass And Miscanthus RhizosphereRDPKGVSRGANGMLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA
Ga0207660_1025817823300025917Corn RhizosphereLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA
Ga0207652_1006167113300025921Corn RhizosphereNGMLEVDTFHGHIRASELKIGPENMPSSIDGGGLIRNKNGELVFG
Ga0207701_1002537773300025930Corn, Switchgrass And Miscanthus RhizosphereGMLEVDTFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA
Ga0207651_1213667013300025960Switchgrass RhizosphereDTFHGHVRASELKIGPENMPSSTEGRGLIRDKHGNLVFA
Ga0207677_1201203023300026023Miscanthus RhizosphereFHGHVKLSELKIGPENMPSSTEGRGLIRDKSGNLVFA
Ga0207676_1151915913300026095Switchgrass RhizosphereDTFHGHIKVSELKISPENMPSSTDGRGLIRDKNGELVFA
Ga0209875_100135613300027209Groundwater SandVDTFHGHVKVSELKIGPENMPSSTGGRGLIRDQNGKLVFAG
Ga0209982_101788933300027552Arabidopsis Thaliana RhizosphereKENGMLEVDTFHGHVRVDELKIGPENMPPSTDGRGLIRDQNGNLVFE
Ga0209465_1002491913300027874Tropical Forest SoilKGVDRRPKEMLEVDTFHGHVKVKDFKISSENMPSSTEGRGLIRDKNGNLVFA
Ga0209705_1061010413300027979Freshwater SedimentVDTFHGHVRVNELKIGPENMPSSRGGAGLIRDKDGKLVFA
Ga0302046_1036616023300030620SoilEVDTFHGHININELKIGPENMPSSADGRGLIRDSQGNLVFA
(restricted) Ga0255312_108848223300031248Sandy SoilEVDTFHGHIKVDELKIGPENMPSSREGRGLIRDQKGNLVFA
Ga0310915_1018289813300031573SoilQGVIEADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA
Ga0318546_1043171713300031771SoilTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA
Ga0307473_1118688423300031820Hardwood Forest SoilGVSRGANGMLEVDTFHGHVKASELKIGPENMPSSTEGRGLIRDKNGDLVFA
Ga0318544_1029807623300031880SoilIEADTFKGLVTVDELKVGPENMPSSRDGRGLLRDATGKLLFA
Ga0310912_1091980813300031941SoilLEVDTFHGHVKVSELKIGPENMPSSTEGRGLIRDKNGNLVFS
Ga0306926_1038209033300031954SoilSGMLEVDTFHGHVNFNELKIGAENMPASTEGRGLIRDKNGKLVFA
Ga0335085_1052367913300032770SoilERQAREMLEVDTFHGHVRVGELKIGPENMPSSTNGRGLLRDKDGNLVFA
Ga0335077_1147246713300033158SoilPPKAVVTNNQGIVEVDTFKGLIKASEIVLGPENMPSSKDGHGLIRDRNSQLVFA
Ga0316619_1115624513300033414SoilGHVHVNELKIGPDNMPSSRNGAGLIRDKAGKLVFA
Ga0364945_0005100_11_1423300034115SedimentMLEVDTFHGHVKINELKIGPENMPSSTNGRGLIRDQNGNLVFA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.