NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101776

Metagenome / Metatranscriptome Family F101776

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101776
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 47 residues
Representative Sequence MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR
Number of Associated Samples 86
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.39 %
% of genes near scaffold ends (potentially truncated) 95.10 %
% of genes from short scaffolds (< 2000 bps) 89.22 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.961 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(24.510 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.47%    β-sheet: 0.00%    Coil/Unstructured: 57.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08376NIT 25.49
PF04286DUF445 5.88
PF07690MFS_1 1.96
PF00155Aminotran_1_2 1.96
PF12852Cupin_6 0.98
PF12833HTH_18 0.98
PF05973Gp49 0.98
PF13577SnoaL_4 0.98
PF04389Peptidase_M28 0.98
PF11288DUF3089 0.98
PF00005ABC_tran 0.98
PF00440TetR_N 0.98
PF11716MDMPI_N 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2733Uncharacterized membrane-anchored protein YjiN, DUF445 familyFunction unknown [S] 5.88
COG4399Uncharacterized membrane protein YheB, UPF0754 familyFunction unknown [S] 5.88
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.98
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.96 %
UnclassifiedrootN/A48.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_101671422Not Available586Open in IMG/M
3300005339|Ga0070660_100731183All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005341|Ga0070691_10116793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1339Open in IMG/M
3300005343|Ga0070687_100263082Not Available1077Open in IMG/M
3300005434|Ga0070709_10131793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1707Open in IMG/M
3300005435|Ga0070714_101012512All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005435|Ga0070714_102072282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas phyllosphaerae554Open in IMG/M
3300005436|Ga0070713_100803893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia901Open in IMG/M
3300005436|Ga0070713_101175032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300005437|Ga0070710_10227943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1188Open in IMG/M
3300005437|Ga0070710_10711811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300005526|Ga0073909_10474023Not Available602Open in IMG/M
3300005560|Ga0066670_10699179Not Available614Open in IMG/M
3300005587|Ga0066654_10045051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1921Open in IMG/M
3300005952|Ga0080026_10045891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1134Open in IMG/M
3300006028|Ga0070717_10009070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora7469Open in IMG/M
3300006028|Ga0070717_10573923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300006028|Ga0070717_12047513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas phyllosphaerae515Open in IMG/M
3300006028|Ga0070717_12099252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300006173|Ga0070716_100043436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2513Open in IMG/M
3300006173|Ga0070716_100619468Not Available816Open in IMG/M
3300006175|Ga0070712_100839973Not Available789Open in IMG/M
3300006755|Ga0079222_10079009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1651Open in IMG/M
3300006791|Ga0066653_10269416All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006806|Ga0079220_10269596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1031Open in IMG/M
3300006954|Ga0079219_10233797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1076Open in IMG/M
3300007788|Ga0099795_10318322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii688Open in IMG/M
3300009093|Ga0105240_12761864Not Available505Open in IMG/M
3300009098|Ga0105245_10768081Not Available1000Open in IMG/M
3300009098|Ga0105245_11336712Not Available766Open in IMG/M
3300009137|Ga0066709_102926873Not Available629Open in IMG/M
3300010359|Ga0126376_11942418Not Available629Open in IMG/M
3300010360|Ga0126372_10748239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii961Open in IMG/M
3300010373|Ga0134128_12841936Not Available533Open in IMG/M
3300010396|Ga0134126_12833951Not Available525Open in IMG/M
3300010396|Ga0134126_13030832Not Available507Open in IMG/M
3300012202|Ga0137363_10746003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii829Open in IMG/M
3300012210|Ga0137378_10586288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1024Open in IMG/M
3300012211|Ga0137377_10682627Not Available962Open in IMG/M
3300012285|Ga0137370_10171201Not Available1264Open in IMG/M
3300012356|Ga0137371_11013920Not Available629Open in IMG/M
3300012361|Ga0137360_11220663Not Available650Open in IMG/M
3300012488|Ga0157343_1018168Not Available613Open in IMG/M
3300012515|Ga0157338_1046408Not Available609Open in IMG/M
3300012955|Ga0164298_10567250Not Available773Open in IMG/M
3300012960|Ga0164301_11134487Not Available624Open in IMG/M
3300012971|Ga0126369_13668677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744503Open in IMG/M
3300013307|Ga0157372_13370241Not Available509Open in IMG/M
3300015241|Ga0137418_10458065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1029Open in IMG/M
3300015241|Ga0137418_10681123Not Available792Open in IMG/M
3300015373|Ga0132257_100548372Not Available1423Open in IMG/M
3300016294|Ga0182041_10379205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1197Open in IMG/M
3300016404|Ga0182037_11719609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300016445|Ga0182038_10931936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia766Open in IMG/M
3300018482|Ga0066669_10085119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2143Open in IMG/M
3300018482|Ga0066669_12222552Not Available521Open in IMG/M
3300020082|Ga0206353_10612705Not Available760Open in IMG/M
3300020581|Ga0210399_10135481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2030Open in IMG/M
3300020581|Ga0210399_10231476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1539Open in IMG/M
3300020582|Ga0210395_10996153Not Available621Open in IMG/M
3300021088|Ga0210404_10482966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii699Open in IMG/M
3300021178|Ga0210408_10484973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii983Open in IMG/M
3300021180|Ga0210396_11223578Not Available628Open in IMG/M
3300021181|Ga0210388_10124701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. OK2282222Open in IMG/M
3300021401|Ga0210393_11155552Not Available624Open in IMG/M
3300021404|Ga0210389_10214975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1500Open in IMG/M
3300021404|Ga0210389_10607967Not Available859Open in IMG/M
3300021478|Ga0210402_10807246Not Available864Open in IMG/M
3300021559|Ga0210409_10506293Not Available1071Open in IMG/M
3300024288|Ga0179589_10116498Not Available1109Open in IMG/M
3300024323|Ga0247666_1083674Not Available635Open in IMG/M
3300025898|Ga0207692_10073770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1806Open in IMG/M
3300025898|Ga0207692_11044946Not Available540Open in IMG/M
3300025905|Ga0207685_10166866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1010Open in IMG/M
3300025912|Ga0207707_10921959Not Available721Open in IMG/M
3300025916|Ga0207663_10577799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia881Open in IMG/M
3300025916|Ga0207663_11332960Not Available578Open in IMG/M
3300025928|Ga0207700_10136453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2010Open in IMG/M
3300025929|Ga0207664_10162745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1904Open in IMG/M
3300025936|Ga0207670_10138809Not Available1790Open in IMG/M
3300026116|Ga0207674_10315380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1513Open in IMG/M
3300026217|Ga0209871_1038604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales900Open in IMG/M
3300026507|Ga0257165_1074260Not Available623Open in IMG/M
3300027855|Ga0209693_10454472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces nodosus616Open in IMG/M
3300028146|Ga0247682_1058382Not Available699Open in IMG/M
3300031779|Ga0318566_10100963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1416Open in IMG/M
3300031799|Ga0318565_10007798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4285Open in IMG/M
3300031820|Ga0307473_10169000Not Available1266Open in IMG/M
3300031823|Ga0307478_11135039Not Available652Open in IMG/M
3300031860|Ga0318495_10370822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300031880|Ga0318544_10162378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii859Open in IMG/M
3300031894|Ga0318522_10046413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1524Open in IMG/M
3300031938|Ga0308175_102066426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300032052|Ga0318506_10058323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1577Open in IMG/M
3300032054|Ga0318570_10498274Not Available556Open in IMG/M
3300032054|Ga0318570_10507701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae550Open in IMG/M
3300032059|Ga0318533_10942209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300034820|Ga0373959_0092721Not Available710Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere18.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10167142223300005331Switchgrass RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPA
Ga0070660_10073118313300005339Corn RhizosphereMMWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP
Ga0070691_1011679313300005341Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETD
Ga0070687_10026308223300005343Switchgrass RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTAL
Ga0070709_1013179323300005434Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR
Ga0070714_10101251213300005435Agricultural SoilMMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETDPALS
Ga0070714_10207228213300005435Agricultural SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAM
Ga0070713_10080389323300005436Corn, Switchgrass And Miscanthus RhizosphereMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETD
Ga0070713_10117503213300005436Corn, Switchgrass And Miscanthus RhizosphereMMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETD
Ga0070710_1022794313300005437Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETD
Ga0070710_1071181113300005437Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALFAML
Ga0073909_1047402333300005526Surface SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTA
Ga0070732_1024616213300005542Surface SoilMTNNDAPSRTGATRRAFLSASAVTAVAVPLLSGTAQAATDPALAPHEPDFELRAL
Ga0066670_1069917913300005560SoilMIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAET
Ga0066654_1004505113300005587SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALS
Ga0080026_1004589113300005952Permafrost SoilLGQSMTNNDVPSRTGATRRTFLSASAVTALAVPLLSGAAQAATDPALAPQE
Ga0070717_1000907013300006028Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVLGRAASTRRAFLSASAVTAVAVPFLSGTALAETDPALSRQ
Ga0070717_1057392313300006028Corn, Switchgrass And Miscanthus RhizosphereMMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAET
Ga0070717_1204751313300006028Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP
Ga0070717_1209925213300006028Corn, Switchgrass And Miscanthus RhizosphereMGMENKDVQARAGSTPLARRAFLSASAVTAVTAPLLTGTALAGTDPALTRQVPDP
Ga0070716_10004343623300006173Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ
Ga0070716_10061946823300006173Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPD
Ga0070712_10083997313300006175Corn, Switchgrass And Miscanthus RhizosphereMENKDVLGRGGSSRRAFLSASAVTAVAVPLLSGTALADTDPALSRQAPDPE
Ga0079222_1007900913300006755Agricultural SoilMSSMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALFAMLREIDPARIRRRS*
Ga0066653_1026941613300006791SoilMIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP
Ga0079220_1026959623300006806Agricultural SoilMENKDVPGRAASTRRAFLSASAVTAVAAPFLSGTALA
Ga0075434_10185152013300006871Populus RhizosphereMMFGMENNDVRGRGGATRRAFLSASAVTAAAVPLLS
Ga0079219_1023379723300006954Agricultural SoilMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQ
Ga0075435_10158512013300007076Populus RhizosphereMENKDVQRRSGSTRRTFLSASAATAVAAPIIAQSVT
Ga0099795_1031832223300007788Vadose Zone SoilMENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQA
Ga0105240_1276186413300009093Corn RhizosphereMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALF
Ga0105245_1076808123300009098Miscanthus RhizosphereMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP
Ga0105245_1133671213300009098Miscanthus RhizosphereMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAM
Ga0066709_10292687313300009137Grasslands SoilMENKDVLGRAGSTRRAFLTASAVTAVAAPLLSGTALAETDPALSRQVPDPAL
Ga0126376_1194241813300010359Tropical Forest SoilMENKDVLGRAGATRRAFLSASAVTAVAVPLLSGTALAETDPALSR
Ga0126372_1074823923300010360Tropical Forest SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR
Ga0134128_1284193623300010373Terrestrial SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAET
Ga0134126_1283395113300010396Terrestrial SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL
Ga0134126_1303083213300010396Terrestrial SoilMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQA
Ga0137363_1074600313300012202Vadose Zone SoilMTSMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPGL
Ga0137378_1058628813300012210Vadose Zone SoilMENTLGGAGSTRRAFLSASAVTAVAVPLLTGTALAG
Ga0137377_1068262713300012211Vadose Zone SoilMQNNDAQVGKGSSRRAFLTASAVTAVTAPLLTGTALAGTSPALVRQEPDEQLR
Ga0137370_1017120113300012285Vadose Zone SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSVTALAETDPALSRQAPD
Ga0137371_1101392013300012356Vadose Zone SoilMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPAL
Ga0137360_1122066323300012361Vadose Zone SoilMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPGLR
Ga0157343_101816813300012488Arabidopsis RhizosphereMENKDVRSRAGSTRRAFLSASAVTAVAVPLLSGTALAETDPALSRQAPDP
Ga0157338_104640813300012515Arabidopsis RhizosphereMMWAMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALIRQAPDPAL
Ga0164298_1056725023300012955SoilMENKDVRSRAGSTRRAFLSASAVTVVAAPLLSGTALAETDPALSRQAPDPALRAML
Ga0164301_1113448713300012960SoilMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTA
Ga0126369_1366867713300012971Tropical Forest SoilMIRGMGNNQSAGRIGATRRAFLSASAVTAAAFPFLTG
Ga0157372_1337024113300013307Corn RhizosphereMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDP
Ga0137418_1045806513300015241Vadose Zone SoilMENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQAPD
Ga0137418_1068112313300015241Vadose Zone SoilMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPA
Ga0132257_10054837223300015373Arabidopsis RhizosphereMENKDVRSRAGSTRRAFLPASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAML
Ga0182041_1037920513300016294SoilMHMENKDVQSRAGSAHLARRTFLSASAVTAVVAPLVSGTALAGTAHAAIRQEPDPGLR
Ga0182037_1171960923300016404SoilMENNDVRSRASSAPLARRAFLSASAVTAVAAPLFSGTA
Ga0182038_1093193613300016445SoilMIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGT
Ga0066669_1008511923300018482Grasslands SoilMESKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL
Ga0066669_1222255213300018482Grasslands SoilMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPD
Ga0206353_1061270513300020082Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP
Ga0210399_1013548143300020581SoilMENKDVQARAGSAPMARRKFLSASAVTAVAVPLISGTALTGTAD
Ga0210399_1023147623300020581SoilMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAE
Ga0210395_1099615323300020582SoilMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ
Ga0210404_1048296623300021088SoilMIWGMENKDVQGRGGSTRRAFLSASAVTAVAAPLLSGTALAETDP
Ga0210408_1048497313300021178SoilMIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALS
Ga0210396_1122357813300021180SoilMENNDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAET
Ga0210388_1012470133300021181SoilMENKDVPGRKGATRRVFLSASAVTAVAAPLLSGTA
Ga0210393_1115555223300021401SoilMENNDVQGRTSSTSLGRRAFLSASAVTAVAAPLLISGPALA
Ga0210389_1021497523300021404SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAADP
Ga0210389_1060796713300021404SoilMIWGMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSR
Ga0210402_1080724623300021478SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLS
Ga0210409_1050629323300021559SoilMPMIWGMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAE
Ga0179589_1011649813300024288Vadose Zone SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAVPLLSGTALAET
Ga0247666_108367413300024323SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAML
Ga0207692_1007377023300025898Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ
Ga0207692_1104494613300025898Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPA
Ga0207685_1016686613300025905Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDP
Ga0207707_1092195913300025912Corn RhizosphereMMWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDP
Ga0207663_1057779923300025916Corn, Switchgrass And Miscanthus RhizosphereMMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETDPALSRQAPDPALRAMLREIDP
Ga0207663_1133296013300025916Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAADP
Ga0207700_1013645323300025928Corn, Switchgrass And Miscanthus RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL
Ga0207664_1016274523300025929Agricultural SoilMENKDVPARAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSR
Ga0207670_1013880923300025936Switchgrass RhizosphereMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRA
Ga0207674_1031538013300026116Corn RhizosphereMMFGMDNDVRGRGGATRRAFLSASAVTAVAAPLLSGTALA
Ga0209871_103860413300026217Permafrost SoilLGQSMTNNDVPSRTGATRRTFLSASAVTALAVPLLSGAAQA
Ga0257165_107426023300026507SoilMIWGMENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQAPDP
Ga0209693_1045447223300027855SoilMENKDVPGRKGATRRVFLSASAVTAVAAPLLSGTALAETDPALARPAPDDGLRAL
Ga0247682_105838213300028146SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAP
Ga0318566_1010096313300031779SoilMIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGTA
Ga0318565_1000779853300031799SoilMADNEVTGRAGSTRRAFLSASAVTAAAVPFLSGTAHA
Ga0307473_1016900023300031820Hardwood Forest SoilMIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETD
Ga0307478_1113503923300031823Hardwood Forest SoilMADKDVSGKAASGRAGATRRAFLSASAVTAVTVPLLGGTAVA
Ga0318495_1037082223300031860SoilMIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTA
Ga0318544_1016237813300031880SoilMENKDVLGRNGATRRAFLSASAVTAVAVPLLSGTALAETDPALSRS
Ga0318522_1004641313300031894SoilMADNEVTGRAGSTRRAFLSASAVTAAAVPFLSGTAHAASGS
Ga0308175_10206642623300031938SoilMMFGMENNDVRGRGGATRRAFLSASAVTAAAVPLLSGTALAETDPALSRQAPDPG
Ga0306922_1022482213300032001SoilMENEDVQAQVGSDRIGRRRFLSASAVTAVAAPLITSTALADA
Ga0318506_1005832323300032052SoilMENKDVLGRNGATRRAFLSASAVTAVAVPLLSGTALAETDPALSRSA
Ga0318570_1049827423300032054SoilMENKDVQSRAGSAHLARRTFLSASAVTAVVAPLVSGTALAG
Ga0318570_1050770113300032054SoilMIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGTADE
Ga0318533_1094220913300032059SoilMENNDVRSRASSAPLARRAFLSASAVTAVAAPLFS
Ga0373959_0092721_1_1683300034820Rhizosphere SoilMIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPAL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.