Basic Information | |
---|---|
Family ID | F101776 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 47 residues |
Representative Sequence | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 19.39 % |
% of genes near scaffold ends (potentially truncated) | 95.10 % |
% of genes from short scaffolds (< 2000 bps) | 89.22 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.961 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.510 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF08376 | NIT | 25.49 |
PF04286 | DUF445 | 5.88 |
PF07690 | MFS_1 | 1.96 |
PF00155 | Aminotran_1_2 | 1.96 |
PF12852 | Cupin_6 | 0.98 |
PF12833 | HTH_18 | 0.98 |
PF05973 | Gp49 | 0.98 |
PF13577 | SnoaL_4 | 0.98 |
PF04389 | Peptidase_M28 | 0.98 |
PF11288 | DUF3089 | 0.98 |
PF00005 | ABC_tran | 0.98 |
PF00440 | TetR_N | 0.98 |
PF11716 | MDMPI_N | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 5.88 |
COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 5.88 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.98 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.96 % |
Unclassified | root | N/A | 48.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005331|Ga0070670_101671422 | Not Available | 586 | Open in IMG/M |
3300005339|Ga0070660_100731183 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300005341|Ga0070691_10116793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1339 | Open in IMG/M |
3300005343|Ga0070687_100263082 | Not Available | 1077 | Open in IMG/M |
3300005434|Ga0070709_10131793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1707 | Open in IMG/M |
3300005435|Ga0070714_101012512 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005435|Ga0070714_102072282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas phyllosphaerae | 554 | Open in IMG/M |
3300005436|Ga0070713_100803893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 901 | Open in IMG/M |
3300005436|Ga0070713_101175032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300005437|Ga0070710_10227943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1188 | Open in IMG/M |
3300005437|Ga0070710_10711811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
3300005526|Ga0073909_10474023 | Not Available | 602 | Open in IMG/M |
3300005560|Ga0066670_10699179 | Not Available | 614 | Open in IMG/M |
3300005587|Ga0066654_10045051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1921 | Open in IMG/M |
3300005952|Ga0080026_10045891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1134 | Open in IMG/M |
3300006028|Ga0070717_10009070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 7469 | Open in IMG/M |
3300006028|Ga0070717_10573923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
3300006028|Ga0070717_12047513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas phyllosphaerae | 515 | Open in IMG/M |
3300006028|Ga0070717_12099252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300006173|Ga0070716_100043436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2513 | Open in IMG/M |
3300006173|Ga0070716_100619468 | Not Available | 816 | Open in IMG/M |
3300006175|Ga0070712_100839973 | Not Available | 789 | Open in IMG/M |
3300006755|Ga0079222_10079009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1651 | Open in IMG/M |
3300006791|Ga0066653_10269416 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300006806|Ga0079220_10269596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1031 | Open in IMG/M |
3300006954|Ga0079219_10233797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1076 | Open in IMG/M |
3300007788|Ga0099795_10318322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 688 | Open in IMG/M |
3300009093|Ga0105240_12761864 | Not Available | 505 | Open in IMG/M |
3300009098|Ga0105245_10768081 | Not Available | 1000 | Open in IMG/M |
3300009098|Ga0105245_11336712 | Not Available | 766 | Open in IMG/M |
3300009137|Ga0066709_102926873 | Not Available | 629 | Open in IMG/M |
3300010359|Ga0126376_11942418 | Not Available | 629 | Open in IMG/M |
3300010360|Ga0126372_10748239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 961 | Open in IMG/M |
3300010373|Ga0134128_12841936 | Not Available | 533 | Open in IMG/M |
3300010396|Ga0134126_12833951 | Not Available | 525 | Open in IMG/M |
3300010396|Ga0134126_13030832 | Not Available | 507 | Open in IMG/M |
3300012202|Ga0137363_10746003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 829 | Open in IMG/M |
3300012210|Ga0137378_10586288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1024 | Open in IMG/M |
3300012211|Ga0137377_10682627 | Not Available | 962 | Open in IMG/M |
3300012285|Ga0137370_10171201 | Not Available | 1264 | Open in IMG/M |
3300012356|Ga0137371_11013920 | Not Available | 629 | Open in IMG/M |
3300012361|Ga0137360_11220663 | Not Available | 650 | Open in IMG/M |
3300012488|Ga0157343_1018168 | Not Available | 613 | Open in IMG/M |
3300012515|Ga0157338_1046408 | Not Available | 609 | Open in IMG/M |
3300012955|Ga0164298_10567250 | Not Available | 773 | Open in IMG/M |
3300012960|Ga0164301_11134487 | Not Available | 624 | Open in IMG/M |
3300012971|Ga0126369_13668677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 503 | Open in IMG/M |
3300013307|Ga0157372_13370241 | Not Available | 509 | Open in IMG/M |
3300015241|Ga0137418_10458065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1029 | Open in IMG/M |
3300015241|Ga0137418_10681123 | Not Available | 792 | Open in IMG/M |
3300015373|Ga0132257_100548372 | Not Available | 1423 | Open in IMG/M |
3300016294|Ga0182041_10379205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1197 | Open in IMG/M |
3300016404|Ga0182037_11719609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300016445|Ga0182038_10931936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300018482|Ga0066669_10085119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2143 | Open in IMG/M |
3300018482|Ga0066669_12222552 | Not Available | 521 | Open in IMG/M |
3300020082|Ga0206353_10612705 | Not Available | 760 | Open in IMG/M |
3300020581|Ga0210399_10135481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2030 | Open in IMG/M |
3300020581|Ga0210399_10231476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1539 | Open in IMG/M |
3300020582|Ga0210395_10996153 | Not Available | 621 | Open in IMG/M |
3300021088|Ga0210404_10482966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 699 | Open in IMG/M |
3300021178|Ga0210408_10484973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 983 | Open in IMG/M |
3300021180|Ga0210396_11223578 | Not Available | 628 | Open in IMG/M |
3300021181|Ga0210388_10124701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. OK228 | 2222 | Open in IMG/M |
3300021401|Ga0210393_11155552 | Not Available | 624 | Open in IMG/M |
3300021404|Ga0210389_10214975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1500 | Open in IMG/M |
3300021404|Ga0210389_10607967 | Not Available | 859 | Open in IMG/M |
3300021478|Ga0210402_10807246 | Not Available | 864 | Open in IMG/M |
3300021559|Ga0210409_10506293 | Not Available | 1071 | Open in IMG/M |
3300024288|Ga0179589_10116498 | Not Available | 1109 | Open in IMG/M |
3300024323|Ga0247666_1083674 | Not Available | 635 | Open in IMG/M |
3300025898|Ga0207692_10073770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1806 | Open in IMG/M |
3300025898|Ga0207692_11044946 | Not Available | 540 | Open in IMG/M |
3300025905|Ga0207685_10166866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1010 | Open in IMG/M |
3300025912|Ga0207707_10921959 | Not Available | 721 | Open in IMG/M |
3300025916|Ga0207663_10577799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
3300025916|Ga0207663_11332960 | Not Available | 578 | Open in IMG/M |
3300025928|Ga0207700_10136453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2010 | Open in IMG/M |
3300025929|Ga0207664_10162745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1904 | Open in IMG/M |
3300025936|Ga0207670_10138809 | Not Available | 1790 | Open in IMG/M |
3300026116|Ga0207674_10315380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1513 | Open in IMG/M |
3300026217|Ga0209871_1038604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 900 | Open in IMG/M |
3300026507|Ga0257165_1074260 | Not Available | 623 | Open in IMG/M |
3300027855|Ga0209693_10454472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces nodosus | 616 | Open in IMG/M |
3300028146|Ga0247682_1058382 | Not Available | 699 | Open in IMG/M |
3300031779|Ga0318566_10100963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1416 | Open in IMG/M |
3300031799|Ga0318565_10007798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4285 | Open in IMG/M |
3300031820|Ga0307473_10169000 | Not Available | 1266 | Open in IMG/M |
3300031823|Ga0307478_11135039 | Not Available | 652 | Open in IMG/M |
3300031860|Ga0318495_10370822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
3300031880|Ga0318544_10162378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 859 | Open in IMG/M |
3300031894|Ga0318522_10046413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
3300031938|Ga0308175_102066426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300032052|Ga0318506_10058323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1577 | Open in IMG/M |
3300032054|Ga0318570_10498274 | Not Available | 556 | Open in IMG/M |
3300032054|Ga0318570_10507701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 550 | Open in IMG/M |
3300032059|Ga0318533_10942209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
3300034820|Ga0373959_0092721 | Not Available | 710 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 18.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070670_1016714222 | 3300005331 | Switchgrass Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPA |
Ga0070660_1007311831 | 3300005339 | Corn Rhizosphere | MMWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP |
Ga0070691_101167931 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETD |
Ga0070687_1002630822 | 3300005343 | Switchgrass Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTAL |
Ga0070709_101317932 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR |
Ga0070714_1010125121 | 3300005435 | Agricultural Soil | MMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETDPALS |
Ga0070714_1020722821 | 3300005435 | Agricultural Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAM |
Ga0070713_1008038932 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETD |
Ga0070713_1011750321 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETD |
Ga0070710_102279431 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETD |
Ga0070710_107118111 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALFAML |
Ga0073909_104740233 | 3300005526 | Surface Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTA |
Ga0070732_102461621 | 3300005542 | Surface Soil | MTNNDAPSRTGATRRAFLSASAVTAVAVPLLSGTAQAATDPALAPHEPDFELRAL |
Ga0066670_106991791 | 3300005560 | Soil | MIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAET |
Ga0066654_100450511 | 3300005587 | Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALS |
Ga0080026_100458911 | 3300005952 | Permafrost Soil | LGQSMTNNDVPSRTGATRRTFLSASAVTALAVPLLSGAAQAATDPALAPQE |
Ga0070717_100090701 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVLGRAASTRRAFLSASAVTAVAVPFLSGTALAETDPALSRQ |
Ga0070717_105739231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAET |
Ga0070717_120475131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP |
Ga0070717_120992521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMENKDVQARAGSTPLARRAFLSASAVTAVTAPLLTGTALAGTDPALTRQVPDP |
Ga0070716_1000434362 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ |
Ga0070716_1006194682 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPD |
Ga0070712_1008399731 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MENKDVLGRGGSSRRAFLSASAVTAVAVPLLSGTALADTDPALSRQAPDPE |
Ga0079222_100790091 | 3300006755 | Agricultural Soil | MSSMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALFAMLREIDPARIRRRS* |
Ga0066653_102694161 | 3300006791 | Soil | MIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP |
Ga0079220_102695962 | 3300006806 | Agricultural Soil | MENKDVPGRAASTRRAFLSASAVTAVAAPFLSGTALA |
Ga0075434_1018515201 | 3300006871 | Populus Rhizosphere | MMFGMENNDVRGRGGATRRAFLSASAVTAAAVPLLS |
Ga0079219_102337972 | 3300006954 | Agricultural Soil | MIWGMENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQ |
Ga0075435_1015851201 | 3300007076 | Populus Rhizosphere | MENKDVQRRSGSTRRTFLSASAATAVAAPIIAQSVT |
Ga0099795_103183222 | 3300007788 | Vadose Zone Soil | MENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQA |
Ga0105240_127618641 | 3300009093 | Corn Rhizosphere | MENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPALF |
Ga0105245_107680812 | 3300009098 | Miscanthus Rhizosphere | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP |
Ga0105245_113367121 | 3300009098 | Miscanthus Rhizosphere | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAM |
Ga0066709_1029268731 | 3300009137 | Grasslands Soil | MENKDVLGRAGSTRRAFLTASAVTAVAAPLLSGTALAETDPALSRQVPDPAL |
Ga0126376_119424181 | 3300010359 | Tropical Forest Soil | MENKDVLGRAGATRRAFLSASAVTAVAVPLLSGTALAETDPALSR |
Ga0126372_107482392 | 3300010360 | Tropical Forest Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSR |
Ga0134128_128419362 | 3300010373 | Terrestrial Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAET |
Ga0134126_128339511 | 3300010396 | Terrestrial Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL |
Ga0134126_130308321 | 3300010396 | Terrestrial Soil | MENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQA |
Ga0137363_107460031 | 3300012202 | Vadose Zone Soil | MTSMIWGMENKDVLGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPGL |
Ga0137378_105862881 | 3300012210 | Vadose Zone Soil | MENTLGGAGSTRRAFLSASAVTAVAVPLLTGTALAG |
Ga0137377_106826271 | 3300012211 | Vadose Zone Soil | MQNNDAQVGKGSSRRAFLTASAVTAVTAPLLTGTALAGTSPALVRQEPDEQLR |
Ga0137370_101712011 | 3300012285 | Vadose Zone Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSVTALAETDPALSRQAPD |
Ga0137371_110139201 | 3300012356 | Vadose Zone Soil | MENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPALSRQVPDPAL |
Ga0137360_112206632 | 3300012361 | Vadose Zone Soil | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPGLR |
Ga0157343_10181681 | 3300012488 | Arabidopsis Rhizosphere | MENKDVRSRAGSTRRAFLSASAVTAVAVPLLSGTALAETDPALSRQAPDP |
Ga0157338_10464081 | 3300012515 | Arabidopsis Rhizosphere | MMWAMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDPALIRQAPDPAL |
Ga0164298_105672502 | 3300012955 | Soil | MENKDVRSRAGSTRRAFLSASAVTVVAAPLLSGTALAETDPALSRQAPDPALRAML |
Ga0164301_111344871 | 3300012960 | Soil | MENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTA |
Ga0126369_136686771 | 3300012971 | Tropical Forest Soil | MIRGMGNNQSAGRIGATRRAFLSASAVTAAAFPFLTG |
Ga0157372_133702411 | 3300013307 | Corn Rhizosphere | MENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDP |
Ga0137418_104580651 | 3300015241 | Vadose Zone Soil | MENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQAPD |
Ga0137418_106811231 | 3300015241 | Vadose Zone Soil | MENKDVLGRAASTRRAFLSASAVTAVAAPFLSGTALAETDPA |
Ga0132257_1005483722 | 3300015373 | Arabidopsis Rhizosphere | MENKDVRSRAGSTRRAFLPASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAML |
Ga0182041_103792051 | 3300016294 | Soil | MHMENKDVQSRAGSAHLARRTFLSASAVTAVVAPLVSGTALAGTAHAAIRQEPDPGLR |
Ga0182037_117196092 | 3300016404 | Soil | MENNDVRSRASSAPLARRAFLSASAVTAVAAPLFSGTA |
Ga0182038_109319361 | 3300016445 | Soil | MIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGT |
Ga0066669_100851192 | 3300018482 | Grasslands Soil | MESKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL |
Ga0066669_122225521 | 3300018482 | Grasslands Soil | MENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPD |
Ga0206353_106127051 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDP |
Ga0210399_101354814 | 3300020581 | Soil | MENKDVQARAGSAPMARRKFLSASAVTAVAVPLISGTALTGTAD |
Ga0210399_102314762 | 3300020581 | Soil | MENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAE |
Ga0210395_109961532 | 3300020582 | Soil | MENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ |
Ga0210404_104829662 | 3300021088 | Soil | MIWGMENKDVQGRGGSTRRAFLSASAVTAVAAPLLSGTALAETDP |
Ga0210408_104849731 | 3300021178 | Soil | MIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALS |
Ga0210396_112235781 | 3300021180 | Soil | MENNDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAET |
Ga0210388_101247013 | 3300021181 | Soil | MENKDVPGRKGATRRVFLSASAVTAVAAPLLSGTA |
Ga0210393_111555522 | 3300021401 | Soil | MENNDVQGRTSSTSLGRRAFLSASAVTAVAAPLLISGPALA |
Ga0210389_102149752 | 3300021404 | Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAADP |
Ga0210389_106079671 | 3300021404 | Soil | MIWGMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSR |
Ga0210402_108072462 | 3300021478 | Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLS |
Ga0210409_105062932 | 3300021559 | Soil | MPMIWGMENKDVPGRAASTRRAFLSASAVTAVAAPLLSGTALAE |
Ga0179589_101164981 | 3300024288 | Vadose Zone Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAVPLLSGTALAET |
Ga0247666_10836741 | 3300024323 | Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRAML |
Ga0207692_100737702 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQ |
Ga0207692_110449461 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPA |
Ga0207685_101668661 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDP |
Ga0207707_109219591 | 3300025912 | Corn Rhizosphere | MMWGMENKDVRSRASSTRRAFLSASAVTAVAAPLLSGTALAETDP |
Ga0207663_105777992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMFGMENNDVRGRGGATRRAFLSASAATAVAVPLLSGTALAETDPALSRQAPDPALRAMLREIDP |
Ga0207663_113329601 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVPGRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAADP |
Ga0207700_101364532 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPAL |
Ga0207664_101627452 | 3300025929 | Agricultural Soil | MENKDVPARAASTRRAFLSASAVTAVAAPLLSGTALAETDPALSR |
Ga0207670_101388092 | 3300025936 | Switchgrass Rhizosphere | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPALRA |
Ga0207674_103153801 | 3300026116 | Corn Rhizosphere | MMFGMDNDVRGRGGATRRAFLSASAVTAVAAPLLSGTALA |
Ga0209871_10386041 | 3300026217 | Permafrost Soil | LGQSMTNNDVPSRTGATRRTFLSASAVTALAVPLLSGAAQA |
Ga0257165_10742602 | 3300026507 | Soil | MIWGMENKDVQGRAGSTRRVFLSASAVTAVAAPFLSGTALAETDPALSRQAPDP |
Ga0209693_104544722 | 3300027855 | Soil | MENKDVPGRKGATRRVFLSASAVTAVAAPLLSGTALAETDPALARPAPDDGLRAL |
Ga0247682_10583821 | 3300028146 | Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAP |
Ga0318566_101009631 | 3300031779 | Soil | MIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGTA |
Ga0318565_100077985 | 3300031799 | Soil | MADNEVTGRAGSTRRAFLSASAVTAAAVPFLSGTAHA |
Ga0307473_101690002 | 3300031820 | Hardwood Forest Soil | MIWGMENKDVLGRAGSTRRAFLSASAVTAVAAPLLSGTALAETD |
Ga0307478_111350392 | 3300031823 | Hardwood Forest Soil | MADKDVSGKAASGRAGATRRAFLSASAVTAVTVPLLGGTAVA |
Ga0318495_103708222 | 3300031860 | Soil | MIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTA |
Ga0318544_101623781 | 3300031880 | Soil | MENKDVLGRNGATRRAFLSASAVTAVAVPLLSGTALAETDPALSRS |
Ga0318522_100464131 | 3300031894 | Soil | MADNEVTGRAGSTRRAFLSASAVTAAAVPFLSGTAHAASGS |
Ga0308175_1020664262 | 3300031938 | Soil | MMFGMENNDVRGRGGATRRAFLSASAVTAAAVPLLSGTALAETDPALSRQAPDPG |
Ga0306922_102248221 | 3300032001 | Soil | MENEDVQAQVGSDRIGRRRFLSASAVTAVAAPLITSTALADA |
Ga0318506_100583232 | 3300032052 | Soil | MENKDVLGRNGATRRAFLSASAVTAVAVPLLSGTALAETDPALSRSA |
Ga0318570_104982742 | 3300032054 | Soil | MENKDVQSRAGSAHLARRTFLSASAVTAVVAPLVSGTALAG |
Ga0318570_105077011 | 3300032054 | Soil | MIRGMENNDVRSGVGSTPLARRTFLSASAVTAVTAPLLISGTALAGTADE |
Ga0318533_109422091 | 3300032059 | Soil | MENNDVRSRASSAPLARRAFLSASAVTAVAAPLFS |
Ga0373959_0092721_1_168 | 3300034820 | Rhizosphere Soil | MIWGMENKDVRSRAGSTRRAFLSASAVTAVAAPLLSGTALAETDPALSRQAPDPAL |
⦗Top⦘ |