NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101944

Metagenome / Metatranscriptome Family F101944

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101944
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 47 residues
Representative Sequence VENMDEVLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN
Number of Associated Samples 93
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 98.04 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.020 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(21.569 % of family members)
Environment Ontology (ENVO) Unclassified
(34.314 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.824 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.89%    β-sheet: 0.00%    Coil/Unstructured: 86.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01926MMR_HSR1 42.16
PF07498Rho_N 20.59
PF04995CcmD 0.98
PF00009GTP_EFTU 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG3114Heme exporter protein DIntracellular trafficking, secretion, and vesicular transport [U] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.02 %
UnclassifiedrootN/A0.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101612141All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300002562|JGI25382J37095_10024108All Organisms → cellular organisms → Bacteria2375Open in IMG/M
3300004133|Ga0058892_1303698All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300004267|Ga0066396_10117701All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004479|Ga0062595_100914872All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005180|Ga0066685_10055364All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300005184|Ga0066671_10405319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales873Open in IMG/M
3300005294|Ga0065705_10529005All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005329|Ga0070683_102095323All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005332|Ga0066388_102475360All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300005332|Ga0066388_107312849All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005434|Ga0070709_10774356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes751Open in IMG/M
3300005446|Ga0066686_10880750All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300005518|Ga0070699_102211839All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005557|Ga0066704_10091846All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300005558|Ga0066698_10731806All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300005577|Ga0068857_100685625All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300005764|Ga0066903_102716973All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300006049|Ga0075417_10018939All Organisms → cellular organisms → Bacteria2715Open in IMG/M
3300006163|Ga0070715_10591392All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006196|Ga0075422_10305230All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006791|Ga0066653_10380151All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300006794|Ga0066658_10841170All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300006845|Ga0075421_101207091All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300006852|Ga0075433_11149070All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300007076|Ga0075435_101073943All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300009089|Ga0099828_10928094All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300009137|Ga0066709_104131003All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009148|Ga0105243_10171294All Organisms → cellular organisms → Bacteria1880Open in IMG/M
3300010046|Ga0126384_10429201All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300010047|Ga0126382_12278164All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010084|Ga0127461_1072549All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300010093|Ga0127490_1005008All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300010104|Ga0127446_1023069All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300010107|Ga0127494_1145090All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300010108|Ga0127474_1013597All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300010109|Ga0127497_1056879All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300010115|Ga0127495_1140801All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300010125|Ga0127443_1140615All Organisms → cellular organisms → Bacteria1750Open in IMG/M
3300010132|Ga0127455_1164476All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300010154|Ga0127503_10851398All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300010323|Ga0134086_10098734All Organisms → cellular organisms → Bacteria → Acidobacteria1030Open in IMG/M
3300010366|Ga0126379_10642886All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300010376|Ga0126381_102684830All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300010398|Ga0126383_13144504All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300011120|Ga0150983_12278554All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300011120|Ga0150983_15696514All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300011416|Ga0137422_1044161All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300012198|Ga0137364_11099436All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012388|Ga0134031_1138573All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300012388|Ga0134031_1193536All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300012390|Ga0134054_1079193All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300012391|Ga0134035_1203728All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300012392|Ga0134043_1172376All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012401|Ga0134055_1090052All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300012403|Ga0134049_1029058All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300012404|Ga0134024_1161103All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012406|Ga0134053_1080669All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300012469|Ga0150984_110242623All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012469|Ga0150984_114130902All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300012918|Ga0137396_10998754All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300012944|Ga0137410_11110256All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300012971|Ga0126369_12447311All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012972|Ga0134077_10097232All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300013297|Ga0157378_11032550All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300013297|Ga0157378_11827792All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300015357|Ga0134072_10378893All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300015359|Ga0134085_10446334All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300015371|Ga0132258_10884642Not Available2255Open in IMG/M
3300015372|Ga0132256_103640852All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300015373|Ga0132257_101177348All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300015373|Ga0132257_102014773All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300015374|Ga0132255_100581572All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300016341|Ga0182035_10629918All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300016422|Ga0182039_10785514All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300017792|Ga0163161_12019261All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300021855|Ga0213854_1035322All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021855|Ga0213854_1051223All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300022510|Ga0242652_1009707All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300022532|Ga0242655_10006325All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300022532|Ga0242655_10088244All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300022533|Ga0242662_10189772All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300022724|Ga0242665_10120704All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300026118|Ga0207675_100731120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1000Open in IMG/M
3300026313|Ga0209761_1034803All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300026536|Ga0209058_1035666All Organisms → cellular organisms → Bacteria3001Open in IMG/M
3300026540|Ga0209376_1033371All Organisms → cellular organisms → Bacteria3184Open in IMG/M
3300026550|Ga0209474_10276739All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300028380|Ga0268265_11812784All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300030939|Ga0138303_1238524All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300030987|Ga0308155_1026443All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031093|Ga0308197_10444047All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031573|Ga0310915_10573044All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031910|Ga0306923_11291526All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300031954|Ga0306926_11866324All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300034662|Ga0314783_027878All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300034664|Ga0314786_128490All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300034665|Ga0314787_117198All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300034669|Ga0314794_159803All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300034669|Ga0314794_167853All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300034670|Ga0314795_112982All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300034676|Ga0314801_047073All Organisms → cellular organisms → Bacteria843Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil21.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.96%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.98%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004133Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010084Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010104Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010107Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010108Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010109Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010115Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010125Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010132Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300021855Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030987Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034670Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10161214123300000364SoilRDEFTVHLVENMDXVLKIALTHEPRPLLXNEEAVAXRPAVGGDGDLQESVMN*
JGI25382J37095_1002410813300002562Grasslands SoilHFVENMDEVLKVALTYKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0058892_130369823300004133Forest SoilLVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN*
Ga0066396_1011770113300004267Tropical Forest SoilMDEVLKIALTHEPRPLLDNEEAVAFRPAVGGDGDLQESVMN*
Ga0062595_10091487233300004479SoilHLVETMDEVLKVALTRQPIPLLERPEDVTFQPPIGGDGDLQESVMN*
Ga0066685_1005536413300005180SoilVENMDEVLKVALTHEPIPLIEEGAQEVPFRPPVDGDGDRQESIMN*
Ga0066671_1040531913300005184SoilIRDEFSVHLVENMDEVLKVALTQQPTPLLQDATEVPFQPPIGGDSDLQESVMN*
Ga0065705_1052900513300005294Switchgrass RhizosphereVENMDEVLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN*
Ga0070683_10209532313300005329Corn RhizosphereNMDEVLKIALTHPPTPILTTPEEVPFRPPIDGDGDLQESVMN*
Ga0066388_10247536023300005332Tropical Forest SoilMDEVLKVALTHEPTPLAEDAAGTVPFRPPVGGDGDLQESIMH*
Ga0066388_10731284913300005332Tropical Forest SoilVENMDEVLKIALTHEPRPLLENQETVPFRPTVSGEGDLQESVMN*
Ga0070709_1077435613300005434Corn, Switchgrass And Miscanthus RhizosphereADIPANIKDEFTVHLVESMDEVLKVALTHQPTPIAEGPEEVPFQPPIGGDPDLQESVMN*
Ga0066686_1088075023300005446SoilENMDEVLKVALTQAPTPLAEDAAGAVPFRPPVGGDGDLQESIMN*
Ga0070699_10221183923300005518Corn, Switchgrass And Miscanthus RhizosphereNMDEVLKIALTHAPTPLIDDGSDELPFRPPVGGDDNLQESIMH*
Ga0066704_1009184613300005557SoilVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0066698_1073180623300005558SoilENMDEVLKVALTQEPTPLIEDGAQGVAFRPPVDGDGDLQESIMH*
Ga0068857_10068562533300005577Corn RhizosphereLVESMDEVLKIALAYAPTPLLKNQDEVPFRPPVSGDGDLQESVMN*
Ga0066903_10271697313300005764Tropical Forest SoilHLVENMDEVLKIALTREPRPLLEAEEAVAFRPAVSGEGDLQESVMN*
Ga0075417_1001893913300006049Populus RhizosphereNMDEVLKIALTHEPCPLLDNEEAVAFRPAVGGDGDLQESVMN*
Ga0070715_1059139223300006163Corn, Switchgrass And Miscanthus RhizosphereVENMDEVLKIALTHAPTPLIDDGAEVPFQTPVGTGGDLQESIMN*
Ga0075422_1030523023300006196Populus RhizosphereVHLVENMDEVLKIALAYAPTPLLMNQEEVPFRPPVSGDGDLQESVMN*
Ga0066653_1038015113300006791SoilNIKDEFTVHLVESMDEVLKVALTYAPTPILEDVPEVTFRPPIGEDGDLQESIMN*
Ga0066658_1084117023300006794SoilVECMDEVLKVALTHEPIPLLQDGPNALTFRTPVGSGGDLQESIMH*
Ga0075421_10120709113300006845Populus RhizospherePNIKDDFTVHLVENMDEVLKIALAHEPTPLMEEGAEVAFPAPIGTDGDLQESIMH*
Ga0075433_1114907023300006852Populus RhizosphereFTVHLVENMDEVLKIALTREPRPLLESEEAVAFRPTVGGDGDLQESVMN*
Ga0075435_10107394313300007076Populus RhizosphereADIPANIRDEFTVHLVENMDEVLKIALTHEPRPLLENEEAVAFRPAVGGDGDLQESVMN*
Ga0099828_1092809423300009089Vadose Zone SoilPANIKDEFTIHFVENMDEVLKVALTYAPTPLLEDGSEEVPFRPPVGGDGDLQESIMH*
Ga0066709_10413100313300009137Grasslands SoilVLKIALTHAPTPLIDDGDELPFRPPVGGDGLQESIMH*
Ga0105243_1017129413300009148Miscanthus RhizosphereVLKIALTRQPIPLLSGAEEVPFRPPIGGDGDLQESIMH*
Ga0126384_1042920113300010046Tropical Forest SoilHLVENMDEVLKIALTHQPTPILTKEEVPFRPPIDGDGDLQESVMN*
Ga0126382_1227816413300010047Tropical Forest SoilEVLKVALAHEPTPLLEGQEEVAFQPPVNGDRDLQESVMN*
Ga0127461_107254913300010084Grasslands SoilNDIPANIRDEFTVHLVENMDEVLKIALTHEPTPLLEGQGEVPFRPPVAGNGDLQESVMN*
Ga0127490_100500833300010093Grasslands SoilEEFTIHFVENMDEVLKVALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN*
Ga0127446_102306933300010104Grasslands SoilVALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN*
Ga0127494_114509033300010107Grasslands SoilFVESMDEVLKVALTHAPTPLIDNGSEEIPFRPTVAGNGDLQESIMH*
Ga0127474_101359713300010108Grasslands SoilIKNEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDGDGDLQESIMH*
Ga0127497_105687913300010109Grasslands SoilIHFVESMDEVLKIALTSAPTPILDDAADDVAFRPPVGGGGDLQESIMH*
Ga0127495_114080133300010115Grasslands SoilANIKDEFTVHLVESMDEVLKVALTSQPTPILEENQEEIPFQSGVGKDGDLHQESIMH*
Ga0127443_114061533300010125Grasslands SoilANIKDEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDSDGDLQESIMH*
Ga0127455_116447623300010132Grasslands SoilKVALVQEPTPLIENPEEVPFRPPVGNGDLQESIMN*
Ga0127503_1085139813300010154SoilFVENMDEVLKIALTHAPTPLIDDGAEVPFQTPVGTGGDLQESIMN*
Ga0134086_1009873413300010323Grasslands SoilTIHFVENMDEVLKVALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN*
Ga0126379_1064288613300010366Tropical Forest SoilKVALTQQPTPLLQTDAVPFQPPIDGDGDLQESVMN*
Ga0126381_10268483013300010376Tropical Forest SoilDEFTVHLVESMDEVLKVALTHQPTPLPKGQEEVPFQPPISGDPDLQESVMN*
Ga0126383_1314450413300010398Tropical Forest SoilENMDEVLKIALTRQPTPLLDTEVPFRPPVNDGGDLQESVMN*
Ga0150983_1227855423300011120Forest SoilAIKDEFTIHFVENMDEVLKVALTHAPIPLIDDGDEVSFRPPADGDGGLQESIMH*
Ga0150983_1569651413300011120Forest SoilVHLVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN*
Ga0137422_104416113300011416SoilENMDEVLKIALTHPPTPLVENQDEVPFRPPVSSDGDLQESVMN*
Ga0137364_1109943623300012198Vadose Zone SoilKIALTHAPTPLIDDGSDELPFRPPVGGDDNLQESIMH*
Ga0134031_113857313300012388Grasslands SoilHFVENMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDSDGDLQESIMH*
Ga0134031_119353613300012388Grasslands SoilPANIKDEFTIHFVESMDEVLKVALTYAPTPLRDNGSDEVPFRPVAGDGDLQESIMH*
Ga0134054_107919343300012390Grasslands SoilKDEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEIPFRPTVAGNGDLQESIMH*
Ga0134035_120372813300012391Grasslands SoilNIKEEFTIHFVENMDEVLKVALTHQPTPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0134043_117237623300012392Grasslands SoilVENMDEVLKVALTHEPTPLLQEARPEQVPFRPPIEGDGDLQESIMN*
Ga0134055_109005233300012401Grasslands SoilANIKDEFTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0134049_102905813300012403Grasslands SoilESMDEVLKIALTHEPTPLLEGQGEVPFRPPVAGNGDLQESVMN*
Ga0134024_116110323300012404Grasslands SoilANIRDEFTVHLVECMDEVLKVALTHEPIPLLQDGPNALTFRTPVGSGGDLQESIMH*
Ga0134053_108066933300012406Grasslands SoilDIPANIKDEFTIHFVENMDEVLKVALTQEPTPLIEEGAQGVPFRPPVDGDGDLQESIMH*
Ga0150984_11024262313300012469Avena Fatua RhizosphereKNEFTVHLVENMDEVLKIALTYAPTPLLEDAEVTFRPPIGQGGNLQEPVMH*
Ga0150984_11413090213300012469Avena Fatua RhizosphereENMDEVLKVALARQPIPILEAQDEVPFQPPVGGDRDLQESVMN*
Ga0137396_1099875413300012918Vadose Zone SoilLTIAPTPLLDDAADELAFRPPVGGGGDLQESIMH*
Ga0137410_1111025623300012944Vadose Zone SoilVENMDEVLKIALTHAPTPLIDDGDEVSFRPPMDGDGGLQESIMH*
Ga0126369_1244731113300012971Tropical Forest SoilMDEVLKVALTHQPTPLLTGPEEVAFQPAIGTDGDLQESVMN*
Ga0134077_1009723213300012972Grasslands SoilFTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0157378_1103255023300013297Miscanthus RhizosphereVENMDEVLKIALTHEPTPLSEHDDVPFQPPASADGNLQESVMN*
Ga0157378_1182779213300013297Miscanthus RhizosphereMDEVLKVALTRQPIPRLERPEDVTFQPPIGGDGDLQESVMN*
Ga0134072_1037889313300015357Grasslands SoilPANIKEEFTIHFVENMDEVLKVALTHQPKPLVEDAAGAVPFRPPVGGDGDLQESIMH*
Ga0134085_1044633423300015359Grasslands SoilFTIHFVESMDEVLKIALTHAPTPLIDDGDELPFRPPVGGDDNLQESIMH*
Ga0132258_1088464213300015371Arabidopsis RhizosphereVHLVENMDEVLKIALANQPIPLLAGQDAVPFQPPVSGDGDLQESVMN*
Ga0132256_10364085223300015372Arabidopsis RhizosphereDEVLKIALTHAPTPLVGDEEVSFRPPVDGDGGLQESIMH*
Ga0132257_10117734833300015373Arabidopsis RhizosphereDIPANIKDEFTVHLVEGMDEVLKVALVHEPTPLLEGQEEVAFQPPVNGDRDLQESVMN*
Ga0132257_10201477313300015373Arabidopsis RhizosphereEFTVHLVENMDEVLKVALTHEPRPLLENEEAVAFRPAVGGDGDLQESVMN*
Ga0132255_10058157233300015374Arabidopsis RhizosphereANIKDEFTVHLVESMDEVLKIALTHEPTPLAEGQDVVPFQPPAGGDGNLQESVMN*
Ga0182035_1062991813300016341SoilKDEFTVHLVESMDEVLKIALTHQPTPILTAEVPFQPPIGGDGDLQESVMN
Ga0182039_1078551413300016422SoilSMDEVLKVALTRAPTPLLADGSEAVGFRPPVGGDGDLQESIMH
Ga0163161_1201926113300017792Switchgrass RhizosphereTDIPANIKDEFTVHLVENMDEVLKIALTHEPTPLSEHDDVPFQPPASADGNLQESVMN
Ga0213854_103532223300021855WatershedsFTVHLVECMDDVLKVALTQAPTPILEDGPEIGFTPPIGTDGDLQESIMN
Ga0213854_105122333300021855WatershedsHLVECMDEVLKVALTYAPTPILEDEPEVTFRPPIGTDGDLQESIMN
Ga0242652_100970723300022510SoilFTVHLVECMDEVLKVALTYAPTPILEDEPEVTFRPPIGTDGDLQESIMN
Ga0242655_1000632533300022532SoilLVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN
Ga0242655_1008824413300022532SoilKDEFTIHFVENMDEVLKIALTHAPTPLIDDGDEVSFRPPVDGDGGLQESIMH
Ga0242662_1018977213300022533SoilEVLKVALTIAPTPLLDDAAEEVTFRPPVGSDGDLQESIMH
Ga0242665_1012070423300022724SoilKIALTHAPKPLIEDGDEVPFRPPVDGDSDLQESIMH
Ga0207675_10073112043300026118Switchgrass RhizosphereLADIPANIRDEFTLHLVESMDEVLKVALTLQPTPLLQEAAEVRFRPPIGEDGDLQESIMH
Ga0209761_103480313300026313Grasslands SoilTDIPANIKDEFTVHLVESMDEVLKVALTSQPTPILEENQEEIPFQSGVGKDGDLHQESIM
Ga0209058_103566613300026536SoilKDEFTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH
Ga0209376_103337113300026540SoilEFTIHFVENMDEVLKVALTHEPIPLIEEGAQEVPFRPPVDGDGDRQESIMN
Ga0209474_1027673933300026550SoilFTIHFVENMDEVLKVALTHKPTPLVEDAAGVVPFRPPVGGDGDLQESIMH
Ga0268265_1181278413300028380Switchgrass RhizosphereVNIKDEFTVHLVESMDEVLKIALAYAPTPLLKNQDEVPFRPPVSGDGDLQESVMN
Ga0138303_123852423300030939SoilVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN
Ga0308155_102644313300030987SoilLVESMDEVLKVALTLQPTPLLQEGPEEVGFRPPIGEDGDLQESIMH
Ga0308197_1044404723300031093SoilEFTVHLVENMDEVLKVALTLQPTPLLQEGPEEVRFRPPIGEDGDLQESIMH
Ga0310915_1057304423300031573SoilEVLKIALTHQPTPILAGEEVPFRPPIGGDGDLQESVMN
Ga0306923_1129152623300031910SoilEVLKIALTHQPTPILTAEVPFQPPIGGDGDLQESVMN
Ga0306926_1186632413300031954SoilVALTHAPTPLLGDGSEAVGFRPPVGGDGDLQESIMH
Ga0314783_027878_2_1243300034662SoilDEVLKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN
Ga0314786_128490_455_5713300034664SoilVLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN
Ga0314787_117198_2_1813300034665SoilTDIPANIKDEFTVHLVENMDEVLKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN
Ga0314794_159803_414_5273300034669SoilLKIALTHQPTPIVTNPDEVPFRPPVSSDGDLQESVMN
Ga0314794_167853_404_5173300034669SoilLKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN
Ga0314795_112982_407_5323300034670SoilMDEVLKVALAYAPKPLLKSQEEVPFQPPVSGDGDLQESVMN
Ga0314801_047073_1_1623300034676SoilIKDEFTVHLVENMDEVLKIALAHAPTPILAGKDEIPFQPPVHGDGDLQESVMN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.