 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F101969 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRVLETLIVVLVVTVAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.39 % |
| % of genes near scaffold ends (potentially truncated) | 31.37 % |
| % of genes from short scaffolds (< 2000 bps) | 85.29 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.588 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 63.04% β-sheet: 0.00% Coil/Unstructured: 36.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02357 | NusG | 3.92 |
| PF01610 | DDE_Tnp_ISL3 | 3.92 |
| PF13490 | zf-HC2 | 1.96 |
| PF00072 | Response_reg | 0.98 |
| PF03092 | BT1 | 0.98 |
| PF04226 | Transgly_assoc | 0.98 |
| PF04392 | ABC_sub_bind | 0.98 |
| PF00496 | SBP_bac_5 | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF13189 | Cytidylate_kin2 | 0.98 |
| PF14534 | DUF4440 | 0.98 |
| PF13751 | DDE_Tnp_1_6 | 0.98 |
| PF13358 | DDE_3 | 0.98 |
| PF14336 | DUF4392 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 3.92 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 3.92 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.98 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.59 % |
| All Organisms | root | All Organisms | 29.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 19.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070691_100691102 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETLIVVLVVTVAFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0070709_103807991 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR* |
| Ga0070713_1016370712 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLDTFIVLLIATVAFLWVILAHSTPEEHARLYDTMGESTHIAWR* |
| Ga0070708_1000682094 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETLIVMLVVTVVFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0070708_1000804125 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALETLVVLTVAIVAFLWVILAHSTPEEHARLHDSLGQSTHIAWR* |
| Ga0070708_1017381362 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALEALVVLTVATVAFLWVILAHSTPEDQARLHDSLGQRTHIAWR* |
| Ga0070706_1000352724 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVSETFIVVLIVAVACLWVILAHSTPEEHARLYDAMGDSTHIA* |
| Ga0070706_1003213011 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLETFIVVFIAAVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0070706_1020445571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0070698_1006155981 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0070697_1003007012 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0070695_1013459852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVMRVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR* |
| Ga0066707_104997473 | 3300005556 | Soil | MRVLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0066691_108314581 | 3300005586 | Soil | MRGLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0075417_107453551 | 3300006049 | Populus Rhizosphere | MRVLETLIVVFVVTVAFMWVILAHTTPEEQARLHDSIGESTHIAWR* |
| Ga0070715_102571581 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHI |
| Ga0070716_1000036371 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0070765_1000967315 | 3300006176 | Soil | MRALETLVVLTIATVAFLWVILAHTTPEEHARLHDSIGQSTHIAWR* |
| Ga0079222_114208563 | 3300006755 | Agricultural Soil | MRVLETSIVLLVVMVAFMWVILTHTTPEEQARLHDSIGESTHIAWR* |
| Ga0075433_110070462 | 3300006852 | Populus Rhizosphere | MRVLETLIVVFVVTVAFMWVILAHTTPEEQARLHDSIGE |
| Ga0075424_1006294953 | 3300006904 | Populus Rhizosphere | MRVLETLIVVFVVTVAFMWVILAHTTPEEQARLHDSIGESTH |
| Ga0099791_101664332 | 3300007255 | Vadose Zone Soil | LIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0099793_103101152 | 3300007258 | Vadose Zone Soil | MRVLETSIVVLVVMVTFMWVILVHTIPEEQACLHDSMGESTHIAWR* |
| Ga0099794_100029717 | 3300007265 | Vadose Zone Soil | MRVLETCIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0099795_105070972 | 3300007788 | Vadose Zone Soil | PQRPEAVMRVLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0099829_109882171 | 3300009038 | Vadose Zone Soil | MRVLETFIVAFIAAVAFMWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0099828_116489871 | 3300009089 | Vadose Zone Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0099792_101333201 | 3300009143 | Vadose Zone Soil | MRVLETSIVVLVVMVTFMWVILAHTTPEEHARLHDSMGESTHIAWR* |
| Ga0105243_129378441 | 3300009148 | Miscanthus Rhizosphere | MRVLETSIVMLVLMVAFLWAILPHTTPEEQARLHDSIGESTHIAWR* |
| Ga0134121_107117871 | 3300010401 | Terrestrial Soil | MRVLETSIVMLVLMVAFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0138514_1001132152 | 3300011003 | Soil | MRVLETSILMLVLMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR* |
| Ga0137392_114122731 | 3300011269 | Vadose Zone Soil | MRVLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137391_100629581 | 3300011270 | Vadose Zone Soil | MRVLETFIVVLIATVAFLWVILAHSTPEEHARLYDAMGDGTHIAWR* |
| Ga0137391_102242162 | 3300011270 | Vadose Zone Soil | MRVLETFIVVFIAAIAFMWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137393_110907541 | 3300011271 | Vadose Zone Soil | MRVLETSIVVLVVMVTFMWVILAHTTPEEHARLHDSMGESTH |
| Ga0137388_109834771 | 3300012189 | Vadose Zone Soil | MRVLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSM |
| Ga0137383_103006213 | 3300012199 | Vadose Zone Soil | MKVGPAEESVMRVLETFIVVLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137399_103134251 | 3300012203 | Vadose Zone Soil | MRVRETFIVVLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137362_102635763 | 3300012205 | Vadose Zone Soil | MRVLETWIVVLIVAVTFMWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137380_103726321 | 3300012206 | Vadose Zone Soil | MRGLETFIVVFIAAVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137381_101524193 | 3300012207 | Vadose Zone Soil | MRGLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137376_105720802 | 3300012208 | Vadose Zone Soil | MRVLETSIVMLVLMVAFMWVILAHTTPEEQARLHDS |
| Ga0137379_103504525 | 3300012209 | Vadose Zone Soil | MKVGPAEESVMRVLETFIVLLIAAVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137377_119665771 | 3300012211 | Vadose Zone Soil | MRVLETFIVVFIAAVAFLWVILAHSTPEEHARLYDAMGEST |
| Ga0137371_113977391 | 3300012356 | Vadose Zone Soil | MRGLETFIVVFIAAVAFMWVILAHATPEEHARLYDAMEESTHIAWR* |
| Ga0137360_109015731 | 3300012361 | Vadose Zone Soil | EESVMRGLETFIVVFIAAFAFRWVILAHSTPEEHARLYDAMGGSTHIAWR* |
| Ga0137361_104351963 | 3300012362 | Vadose Zone Soil | MRVLETFIVVLVAKVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137361_111051632 | 3300012362 | Vadose Zone Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHACLYDAMGDSTHIAWR* |
| Ga0137361_116004381 | 3300012362 | Vadose Zone Soil | MRVRETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137390_103038944 | 3300012363 | Vadose Zone Soil | ESVMRVLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137390_117025211 | 3300012363 | Vadose Zone Soil | MRVLETFIVVFIAAVAFMWVILAHSTPEEHARLYDA |
| Ga0137390_118402392 | 3300012363 | Vadose Zone Soil | GSVMRVLETFIVVLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR* |
| Ga0137359_102400213 | 3300012923 | Vadose Zone Soil | VIRALETFIVVLVATVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR* |
| Ga0137359_102996371 | 3300012923 | Vadose Zone Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWQ* |
| Ga0137359_117190171 | 3300012923 | Vadose Zone Soil | MRVLETSIVVLVVMVTFMWVILAHTTTEEQARLHDSMGESTHIAWR* |
| Ga0137419_102779451 | 3300012925 | Vadose Zone Soil | VLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR* |
| Ga0137404_112473491 | 3300012929 | Vadose Zone Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTH |
| Ga0180063_10762432 | 3300014885 | Soil | MRVLETFIVVLIATVAFLWVILAYSTSEEHARLHDSIGESTHIAWR* |
| Ga0187824_100924432 | 3300017927 | Freshwater Sediment | MRVLETLIVVLVVTVAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0187824_100977082 | 3300017927 | Freshwater Sediment | MRALETLIVVLVVTVAFMWVILAHSTPEEQARLHDSMGESTHIAWR |
| Ga0187821_100714642 | 3300017936 | Freshwater Sediment | MRVLETLIVVLVGHGRVHVILAHTMPEEHARLYDAMGESTHIAWR |
| Ga0193722_10600101 | 3300019877 | Soil | MRVLETSIVMLVIMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0210407_100929113 | 3300020579 | Soil | MRVLETLIVLFVVTVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0210399_100450788 | 3300020581 | Soil | MRALETLVVLTIVTVTFLWVILAHTTPEEHARLHDSIGQSTHIAWR |
| Ga0210400_109493521 | 3300021170 | Soil | MRVLETAIVVLVVTVTFMWVILAHTTPEEQARLHDSMGESTRIAWR |
| Ga0210408_100860732 | 3300021178 | Soil | MRVLETAIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTRIAWR |
| Ga0210408_105743562 | 3300021178 | Soil | MRALETLVVLTIATVAFLWVILAHTTPEEHARLHDSIGQSTHIAWR |
| Ga0207684_100180446 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALETLVVLTVAIVAFLWVILAHSTPEEHARLHDSLGQSTHIAWR |
| Ga0207684_100384993 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVSETFIVVLIVAVACLWVILAHSTPEEHARLYDAMGDSTHIA |
| Ga0207684_105542912 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0207684_106613481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGLETFIVVFIAAVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR |
| Ga0207646_100424404 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLETLIVMLVVTVVFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0207646_100876423 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALEALVVLTVATVAFLWVILAHSTPEDQARLHDSLGQRTHIAWR |
| Ga0208285_10099631 | 3300026005 | Rice Paddy Soil | MRVLETLIVVLVVTVAFMWVILAHTTPEEQARLHD |
| Ga0209438_10392283 | 3300026285 | Grasslands Soil | MRVRETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGDSTHIAWR |
| Ga0209158_12732762 | 3300026333 | Soil | MRGLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGESTHIAWR |
| Ga0257180_10145541 | 3300026354 | Soil | VLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR |
| Ga0257176_10094511 | 3300026361 | Soil | IATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR |
| Ga0257178_10157811 | 3300026446 | Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGERTHIAWR |
| Ga0257147_10069573 | 3300026475 | Soil | CMRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR |
| Ga0257147_10329082 | 3300026475 | Soil | RVLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0257164_10267653 | 3300026497 | Soil | PQRQEAVMRVLETSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0257168_10514872 | 3300026514 | Soil | MRVLETFIVVFIAAVAFMWVILAHSTPEEHARLYDAMGDSTHIAWR |
| Ga0209117_10143624 | 3300027645 | Forest Soil | MRVRETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTHIAWR |
| Ga0209217_10739021 | 3300027651 | Forest Soil | MRVLETSIVMLVLMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0209217_11410622 | 3300027651 | Forest Soil | MRALETLVVLTVATVAFLWVILAHSTPEEHARLLDSIGQSTHIAWR |
| Ga0307310_106103421 | 3300028824 | Soil | MRVLETSIVMLVVMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0222749_100555493 | 3300029636 | Soil | MRILETSIVMLVLMVAFMWVILAHTTPEEQARLHDSMGESTRIAWR |
| (restricted) Ga0255312_11151533 | 3300031248 | Sandy Soil | MRALETLIVLAVVTVGFLWAILGHSTPEEHARLYDSMGESTHI |
| (restricted) Ga0255312_11559681 | 3300031248 | Sandy Soil | MRVLETLIVVLVVTAAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0307469_104683192 | 3300031720 | Hardwood Forest Soil | VVLTVAIVAFLWVILAHSTPEEHARLHDSLGQSTHIAWR |
| Ga0307469_121975281 | 3300031720 | Hardwood Forest Soil | RPEAVMRVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0307468_1014764921 | 3300031740 | Hardwood Forest Soil | MRVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSIGESTHNAWR |
| Ga0307475_114210011 | 3300031754 | Hardwood Forest Soil | RVLETSIVVLVVMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0307473_101619954 | 3300031820 | Hardwood Forest Soil | MRALETLVVLTIATVAFLWVILAHTTPEEHARLHDSIGQSTHVAWR |
| Ga0307470_101471522 | 3300032174 | Hardwood Forest Soil | MRVLETSIVMLVLMVAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0307471_1025931191 | 3300032180 | Hardwood Forest Soil | MRVLETFIVLLIATVAFLWVILAHSTPEEHARLYDAMGESTQIAWRLGSAGP |
| Ga0307471_1027219521 | 3300032180 | Hardwood Forest Soil | MRILETSIVMLVLMVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0307472_1005872852 | 3300032205 | Hardwood Forest Soil | TSIVVLVVMVAFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0307472_1006459451 | 3300032205 | Hardwood Forest Soil | TSIVVLVVMVTFMWVILAHTTPEEQARLHDSMGESTHIAWR |
| Ga0307472_1013970911 | 3300032205 | Hardwood Forest Soil | VLETLIVVFVVTVAFMWVILAHTTPEEQARLHDSIGESTHIAWR |
| Ga0326726_113850081 | 3300033433 | Peat Soil | MRFLETLIVVLVVTVAFMWVILAHTTPEERARLHD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |