NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102158

Metagenome / Metatranscriptome Family F102158

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102158
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 46 residues
Representative Sequence MSPQNNQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGAE
Number of Associated Samples 98
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.471 % of family members)
Environment Ontology (ENVO) Unclassified
(27.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.39%    β-sheet: 0.00%    Coil/Unstructured: 48.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF13432TPR_16 35.29
PF14559TPR_19 16.67
PF13414TPR_11 3.92
PF00266Aminotran_5 2.94
PF04389Peptidase_M28 0.98



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001359|A3035W6_1108238All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300001565|A35518A_1001625All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300001661|JGI12053J15887_10372993All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300002915|JGI25387J43893_1076782All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300003579|Ga0007429J51699_1094999All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis641Open in IMG/M
3300004156|Ga0062589_102506975All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis534Open in IMG/M
3300004479|Ga0062595_101694409All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis595Open in IMG/M
3300005330|Ga0070690_100370235All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1045Open in IMG/M
3300005336|Ga0070680_100349202All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1258Open in IMG/M
3300005336|Ga0070680_100797699All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis814Open in IMG/M
3300005337|Ga0070682_100309914All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005345|Ga0070692_10761066All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005547|Ga0070693_101089594All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis608Open in IMG/M
3300005549|Ga0070704_100765335All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis861Open in IMG/M
3300005560|Ga0066670_10049041All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2179Open in IMG/M
3300005568|Ga0066703_10120950All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1557Open in IMG/M
3300006854|Ga0075425_100304689All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1833Open in IMG/M
3300007076|Ga0075435_101689432All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis556Open in IMG/M
3300007740|Ga0104326_112021All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300009012|Ga0066710_102459824All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300009029|Ga0066793_10169212All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300009143|Ga0099792_10601760All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300009553|Ga0105249_12378110All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010090|Ga0127471_1085849All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010103|Ga0127500_1013637All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300010115|Ga0127495_1050084All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010116|Ga0127466_1011506All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300010301|Ga0134070_10143370All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300010320|Ga0134109_10146574All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300010364|Ga0134066_10034762All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300010373|Ga0134128_11256374All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300011444|Ga0137463_1208162All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300012091|Ga0136625_1069865All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1250Open in IMG/M
3300012200|Ga0137382_10787674All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012208|Ga0137376_11275235All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012211|Ga0137377_10143053All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2289Open in IMG/M
3300012398|Ga0134051_1229847All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis868Open in IMG/M
3300012401|Ga0134055_1198303All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012469|Ga0150984_122514855All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012685|Ga0137397_10913843All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300012924|Ga0137413_10066469All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2145Open in IMG/M
3300012955|Ga0164298_11148603All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012977|Ga0134087_10173149All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300012985|Ga0164308_11623227All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300013763|Ga0120179_1001905All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis6915Open in IMG/M
3300014745|Ga0157377_10320560All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300015264|Ga0137403_10833637All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300017656|Ga0134112_10448344All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300017659|Ga0134083_10608174All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300018071|Ga0184618_10484182All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018429|Ga0190272_10351219All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300018433|Ga0066667_11103753All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300019254|Ga0184641_1150936All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300019868|Ga0193720_1054837All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300019877|Ga0193722_1116522All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300019879|Ga0193723_1006199All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4002Open in IMG/M
3300019885|Ga0193747_1087083All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300020004|Ga0193755_1234280All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300020010|Ga0193749_1025656All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300020021|Ga0193726_1315960All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021418|Ga0193695_1035718All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300021445|Ga0182009_10396517All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300021510|Ga0222621_1016455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1457Open in IMG/M
3300022756|Ga0222622_10321024All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300022898|Ga0247745_1043154All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300023058|Ga0193714_1011885All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300023058|Ga0193714_1023373All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300024283|Ga0247670_1009483All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1770Open in IMG/M
3300024330|Ga0137417_1118951All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300025912|Ga0207707_11217585All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300025921|Ga0207652_10412211All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300025942|Ga0207689_11537048All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025960|Ga0207651_12005950All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300026023|Ga0207677_10388523All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300026078|Ga0207702_11630824All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300026301|Ga0209238_1130332All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300026310|Ga0209239_1198034All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026324|Ga0209470_1230718All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300026325|Ga0209152_10063804All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300026325|Ga0209152_10234895All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300026529|Ga0209806_1024326All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3073Open in IMG/M
3300026530|Ga0209807_1134878All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300026547|Ga0209156_10282091All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300027360|Ga0209969_1020010All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300027603|Ga0209331_1065025All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300027637|Ga0209818_1032142All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300027639|Ga0209387_1055376All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis884Open in IMG/M
3300027903|Ga0209488_10472356All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium922Open in IMG/M
3300028717|Ga0307298_10096573All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300028768|Ga0307280_10194730All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300028768|Ga0307280_10382862All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300028828|Ga0307312_10578768All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300028884|Ga0307308_10544693All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300028885|Ga0307304_10296348All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300030989|Ga0308196_1013885All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031081|Ga0308185_1026346All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300031096|Ga0308193_1025406All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300031098|Ga0308191_1012699All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031114|Ga0308187_10125466All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300031716|Ga0310813_10457191All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300032122|Ga0310895_10054808All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1479Open in IMG/M
3300034681|Ga0370546_078603All Organisms → cellular organisms → Bacteria550Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil11.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.90%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.98%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001359Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001565Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina newEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300003579Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007740Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010090Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010103Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010115Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010116Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A3035W6_110823813300001359PermafrostMSPQSSQAAIAALNGVHPVLAHFDKPRSAEDLAADIID
A35518A_100162513300001565PermafrostMSPANTQAALAALNGARPVLAHFNTPRSAEDLAADIIDLWTGV
JGI12053J15887_1037299313300001661Forest SoilVSPPNTQAALTALNGVRPVLTHFETSRAAEDLAADIIDLWSGAEASLQALV
JGI25387J43893_107678223300002915Grasslands SoilVSPQNSQGALTALNGVRPVLTHFETSRSAEDLAADIIDLWTGVET
Ga0007429J51699_109499923300003579Avena Fatua RhizosphereMSPQNNPGALAALNGARPVLANFDKARSAEDLAADIIDLWTAAEQALQAMVGNASLTG
Ga0062589_10250697513300004156SoilMSPANTQAALAALNGVRPVLSHFDSPRSAEDLAADIIDLWVGAEAS
Ga0062595_10169440913300004479SoilMSPQNNPGAVAALNGARPVLAHFDQPRSAEDLAADIIDLWSGAESALQSVVGNTSLSGQQ
Ga0070690_10037023513300005330Switchgrass RhizosphereMSPQNTPGAVSALNGARPVLAHFEKPRSAEDLAADIIDLWTGAESALQSLVGNASLTG
Ga0070680_10034920223300005336Corn RhizosphereMSPQNNQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGAE
Ga0070680_10079769923300005336Corn RhizosphereMSPRNNPGALAALSGARPVLANFGKARSAEDLAADIIDLWTAAEQALQALVGNASLTG
Ga0070682_10030991413300005337Corn RhizosphereMSPQSTQAALASLNGARPVLAHFDQPRSAEDLAADIIDLW
Ga0070692_1076106613300005345Corn, Switchgrass And Miscanthus RhizosphereMSPQNNPGALAALKGARPVLAHFDKSRSAEDLAADIIDLW
Ga0070693_10108959413300005547Corn, Switchgrass And Miscanthus RhizosphereMSPQNTQAALASLNGARPVLAHFDQPRSAEDLAADIIDLWTGVEGALQTLVGNSSLTG
Ga0070704_10076533513300005549Corn, Switchgrass And Miscanthus RhizosphereMSPQSTQAALASLNGARPVLAHFDQPRSAEDLAADIIDLWSGVESALQ
Ga0066670_1004904133300005560SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIIDLWTGAEGALQALVGN
Ga0066703_1012095013300005568SoilMSPQNTPGALASLNGVRPVLAHFETPRSAEDLAADIIDLWTGAEGALQ
Ga0075425_10030468933300006854Populus RhizosphereMSPQSTQAALASLNGARPVLAHFDQPRSAEDLAADI
Ga0075435_10168943223300007076Populus RhizosphereMSPQNTPGALASLNGVRPVLAHFERPRSAEDLAADIIDLWT
Ga0104326_11202123300007740SoilVSPQNSQAALTAMNGVRPVLTHFETPRAAEDLAADIIDLWTGAEASLQALVG
Ga0066710_10245982423300009012Grasslands SoilMSPQNTPGALASLNGVRPVLAHFETPRSAEDLAADIIDLWTGAE
Ga0066793_1016921223300009029Prmafrost SoilVSPQNSKAALTALNGVRPVLTHFGTPRAAEDLAADIIDLWTGAEASV
Ga0099792_1060176013300009143Vadose Zone SoilMSPANTQAALAALSGARPILAHFNTPRSAEDLAADI
Ga0105249_1237811013300009553Switchgrass RhizosphereMSPQNTPGAVSALNGARPVLAHFEKPRSAEDLAADI
Ga0127471_108584923300010090Grasslands SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIIDLWTGAEGALQSLVGNS
Ga0127500_101363723300010103Grasslands SoilVSPQNTQAALAALNGARPVLAHFDSPRSAEDLAADIIDLW
Ga0127495_105008413300010115Grasslands SoilVSPQNTQAALTVLNGARPVLAHFDSPRSAEDLAADIIDLWTGAEGALQALVGNS
Ga0127466_101150613300010116Grasslands SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIIDL
Ga0134070_1014337023300010301Grasslands SoilMSPQNSQAALASLNGVRPVLAHFDTPRSAEDLAADIIDLWTG
Ga0134109_1014657423300010320Grasslands SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIIDLWTGAEGALQSLVGN
Ga0134066_1003476223300010364Grasslands SoilMSPQNNQAALASLNGARPVLAHFDQPRSAEDLAADIIDLWTGVEAALQTLVGNS
Ga0134128_1125637413300010373Terrestrial SoilMSPQNTQAALASLNGARPVLAHFDQPRSAEDLAADIIDLWTGVEGALQTLVGNSS
Ga0137463_120816213300011444SoilMSPQSSQAAIAALNGVHPVLAHFDKPRSAEDLAADIIDLWAGAESALQALVGNSSLTGQ
Ga0136625_106986513300012091Polar Desert SandVTPASSGALTALNGVRPVLSHFDNPRSAEDLAADIIDLWTGVESSLRALVGGSALS
Ga0137382_1078767423300012200Vadose Zone SoilMSPRNNPGALAALSGARPVLAHFDKARSAEDLAADIIDLWTAA
Ga0137376_1127523523300012208Vadose Zone SoilMSPQNTPGALAAVNGARPILAHFSTPRSAEDLAADIIDLWAAAETALQALVGNGSLTGQ
Ga0137377_1014305333300012211Vadose Zone SoilMSPQSSQAALAALNGVRPVLAHFDKPRSAEDLAAD
Ga0134051_122984723300012398Grasslands SoilMSPQNTPGALAALNGARPVLAHFESPRSAEDLAADIIDLWSAAEGALQALVGNSSLTG
Ga0134055_119830323300012401Grasslands SoilMSPQNNPGALAALNGARPVLANFGKARSAEDLAADIIDLWTAAEQALQALVGNASLT
Ga0150984_12251485523300012469Avena Fatua RhizosphereMSPQNNPGAVAALNGARPVLSHFDQPRSAEDLAADIID
Ga0137397_1091384323300012685Vadose Zone SoilMSPQSSQAALSALNGVRPVLAHFETPRNAEDLAADII
Ga0137413_1006646913300012924Vadose Zone SoilMSPANTQAALAALSGARPILAHFNTPRSAEDLAADIIDLWTGVERSLQALI
Ga0164298_1114860313300012955SoilMSPQGSQAAVSALNGVRPVLAHFETPRNAEDLAADIIDLWAGVESSLQ
Ga0134087_1017314913300012977Grasslands SoilMSPQNNPGALAALNGARPVLANFDKARSAEDLAADIID
Ga0164308_1162322723300012985SoilMSPQNNPGAVAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGA
Ga0120179_100190563300013763PermafrostVSPQNSQAALTALNGVRPVLTHFETSRAAEDLAADIIDLWTGAE
Ga0157377_1032056023300014745Miscanthus RhizosphereMSPQNTPGAVSALNGARPVLAHFEKPRSAEDLAADIIDLWTGAESALQSLVGNASLTGQ
Ga0137403_1083363713300015264Vadose Zone SoilMSPQNTPGAIAALNGARPVLANFDKPRSAEDLAADIIDLWAAAEVALQALVGNS
Ga0134112_1044834413300017656Grasslands SoilMSPANTQAAQNALNAVRPTLAHFDTPRNAEDLAADV
Ga0134083_1060817413300017659Grasslands SoilMSPQKNPGALAALNGARPVLANFGKARSAEDLAADIIDLWTAAEQALQALVGN
Ga0184618_1048418213300018071Groundwater SedimentMSPQNSQAALAALNSARPVLAHFDTPRSTEDLAADIIDLWTGAEASLQALV
Ga0190272_1035121913300018429SoilVTPASSAALAALNGVRPVLTHFETPRGGEDLAADIIDLWT
Ga0066667_1110375323300018433Grasslands SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIIDLWTGAEGALQSLVGNSSLTAQ
Ga0184641_115093613300019254Groundwater SedimentMSPQNSQAALAALAGARPVLAHFETPRSAEDLAADIIDLWTGVESALQALVDRE
Ga0193720_105483713300019868SoilMSPQSSQAALSALNGVRAVLAHFERPRNAEDLAADIIDLWAGVESSLQ
Ga0193722_111652223300019877SoilVSPQNSQTALTALNGVRPVLAHFDSPRNAEDLAADVIDLW
Ga0193723_100619913300019879SoilMSPQGSQAAVSALNGVRPVLAHFETPRNAEDLAADIIDLWAGVESSLQA
Ga0193747_108708313300019885SoilMSPQGSQAALSALNGVRPVLAHFETPRNAEDLAADIIDLWAGVESALQA
Ga0193755_123428023300020004SoilMSPQGSQAAVSALNGVRPVLAHFETPRNAEDLAADIIDLWAGVEGSLQALVGNSSLTGQ
Ga0193749_102565613300020010SoilMSPQSSQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWAGAESALQT
Ga0193726_131596023300020021SoilMSPQSSQALSALNGVRPVLAHFDKPRSAEDLAADIIDLWTGAESALQALVGNPSLT
Ga0193695_103571823300021418SoilMSPQNSQAALAALNGARPVLAHFETSRSTEDLAADI
Ga0182009_1039651713300021445SoilVSPQNNQAALTALNGARPVLAHFDTPRSAEDLAADIIDLWGG
Ga0222621_101645513300021510Groundwater SedimentMSPQSSQAALSALNGVRAVLAHFERPRNAEDLAADIIDLWAGVENS
Ga0222622_1032102423300022756Groundwater SedimentMSPQSSQAALAALNGARPVLAHFETSRSAEDLAADIIDL
Ga0247745_104315423300022898SoilMSPQNTPGAVSALNGARPVLAHFEKPRSAEDLAADII
Ga0193714_101188513300023058SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESALQSL
Ga0193714_102337313300023058SoilMSPQGSQAALSALNGVRPVLAHFETPRNAEDLAADIIDLWA
Ga0247670_100948333300024283SoilMSPQNNQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGA
Ga0137417_111895123300024330Vadose Zone SoilMSPQNTPSALAALNGARATLAHFETPRNAEDLAADIIDLW
Ga0207707_1121758523300025912Corn RhizosphereMSPQNNQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGAERSL
Ga0207652_1041221113300025921Corn RhizosphereMSPRNNPGALAALSGARPVLANFGKARSAEDLAADI
Ga0207689_1153704813300025942Miscanthus RhizosphereMSPQNTPGAVSALNGARPVLAHFEKPRSAEDLAADIIDLWT
Ga0207651_1200595013300025960Switchgrass RhizosphereMSPQNNQAALAALNGVRPVLAHFDKPRSAEDLAADIIDLWTGAER
Ga0207677_1038852323300026023Miscanthus RhizosphereMSPQNTQAALASLNGARPVLAHFDQPRSAEDLAADIIDLWTGVEGA
Ga0207702_1163082413300026078Corn RhizosphereMSPQNNPSALAALNGARPVLAHFDQPRSAEDLAADI
Ga0209238_113033213300026301Grasslands SoilMSPQSKQAALASLNGARSVLAHFDQPRSAEDLAADIIDLWS
Ga0209239_119803413300026310Grasslands SoilMSPQNNPGAVTSLNGVRPVLAHFDTPRSAEDLAADIIDLWAGAEGS
Ga0209470_123071823300026324SoilMSPQNTPGALAALNGARPVLAHFESPRSAEDLAADI
Ga0209152_1006380413300026325SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAADIID
Ga0209152_1023489513300026325SoilMSPQNTPGALASLNGVRPVLAHFETPRSAEDLAADIIDLWTGAEGALQALV
Ga0209806_102432643300026529SoilMSPQNTPGALASLNGVRPVLAHFETPRSAEDLAADIIDLWTGAEGAL
Ga0209807_113487823300026530SoilMSPQNNPGAVTSLNGVRPVLAHFDTPRSAEDLAADIIDLWAGAEGSLQSLVGNSSLTGQQ
Ga0209156_1028209113300026547SoilMSPQNTPGALASLNGVRPVLAHFDTPRSAEDLAAD
Ga0209969_102001013300027360Arabidopsis Thaliana RhizosphereMSPQVNQAAIAALNGVRPVLSHFDSPRSAEDLAADIIDLWAGAESSL
Ga0209331_106502513300027603Forest SoilVSPPNSQAALTALNGVRPVLTHFETSRAAEDLAADIIDLWSGAETSLQALVGNSSL
Ga0209818_103214213300027637Agricultural SoilVTPASSGALAALNGVRPVLTHFETPRGAEDLAADIIDLWTGVESSLR
Ga0209387_105537613300027639Agricultural SoilVTPASSGALAALNGVRPVLTHFETPRGAEDLAADIIDLWTGVESSLRALVGGSSL
Ga0209488_1047235623300027903Vadose Zone SoilMSPQGSQAALSALNGVRPVLAHFETPRNAEDLAADIIERRVMNAE
Ga0307298_1009657323300028717SoilMSPQSSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESSLQSLVGNP
Ga0307280_1019473013300028768SoilMSPANTQAAQAALSGVRPVLAHFNTPRSAEDLAADIIDLWTGVAR
Ga0307280_1038286213300028768SoilVSPQNSQAALTALNGVRPVLTHFETPRNAEDLAAD
Ga0307312_1057876813300028828SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESSLQ
Ga0307308_1054469323300028884SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWA
Ga0307304_1029634823300028885SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESAL
Ga0308196_101388523300030989SoilMSPQSSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWA
Ga0308185_102634623300031081SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESALQSLVGNSSL
Ga0308193_102540613300031096SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDL
Ga0308191_101269923300031098SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVE
Ga0308187_1012546623300031114SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWAGVESSLQSLVGNSSL
Ga0310813_1045719113300031716SoilMSPQNNPSALAALNGARPVLAHFDQPRSAEDLAADIIDLWTGAESALQA
Ga0310895_1005480833300032122SoilMSPRNNPGALAALSGARPVLANFGKARSAEDLAADIIDLWTAAEQALQA
Ga0370546_078603_376_5493300034681SoilMSPQNSQAALAALNGARPVLAHFETSRSAEDLAADIIDLWTGVESALQSLVGNSSLTG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.