Metagenome Family F102263

Basic Information
Family ID	F102263
Family Type	Metagenome
Number of Sequences	101
Average Sequence Length	36 residues
Representative Sequence	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV
Number of Associated Samples	12
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	55.32 %
% of genes near scaffold ends (potentially truncated)	41.58 %
% of genes from short scaffolds (< 2000 bps)	78.22 %
Associated GOLD sequencing projects	12
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (77.228 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms (99.010 % of family members)
Environment Ontology (ENVO)	Unclassified (99.010 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (99.010 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 18.75% β-sheet: 0.00% Coil/Unstructured: 81.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF00732	GMC_oxred_N	1.98
PF00078	RVT_1	0.99
PF02127	Peptidase_M18	0.99
PF07714	PK_Tyr_Ser-Thr	0.99

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.96
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	1.98
COG1362	Aspartyl aminopeptidase	Amino acid transport and metabolism [E]	0.99
COG1363	Putative aminopeptidase FrvX	Carbohydrate transport and metabolism [G]	0.99

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
All Organisms	root	All Organisms	22.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
cellular organisms	root	All Organisms → cellular organisms	21.78 %
Viruses	superkingdom	All Organisms → Viruses	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	11.88 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	9.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	11.88 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	7.92 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	11.88 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	11.88 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	11.88 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	11.88 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	11.88 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.98 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	1.98 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	11.88 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	1.98 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.99 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.99 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.99 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.23 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11.88 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.99 %
Trichostrongyloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	0.99 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.99 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300010288\|Ga0116210_1097936	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	559	Open in IMG/M
3300010290\|Ga0126333_1017206	Not Available	3174	Open in IMG/M
3300010290\|Ga0126333_1018605	Not Available	3089	Open in IMG/M
3300010290\|Ga0126333_1061238	Not Available	1903	Open in IMG/M
3300010290\|Ga0126333_1084099	Not Available	1616	Open in IMG/M
3300010290\|Ga0126333_1164413	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1053	Open in IMG/M
3300010290\|Ga0126333_1172437	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1017	Open in IMG/M
3300010290\|Ga0126333_1231832	Not Available	798	Open in IMG/M
3300010290\|Ga0126333_1278235	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	675	Open in IMG/M
3300010290\|Ga0126333_1299712	Not Available	628	Open in IMG/M
3300010292\|Ga0126326_1013269	Not Available	3328	Open in IMG/M
3300010292\|Ga0126326_1064490	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1806	Open in IMG/M
3300010292\|Ga0126326_1154333	Not Available	1107	Open in IMG/M
3300010292\|Ga0126326_1247308	Not Available	780	Open in IMG/M
3300010292\|Ga0126326_1263289	Not Available	740	Open in IMG/M
3300010292\|Ga0126326_1296053	Not Available	668	Open in IMG/M
3300010292\|Ga0126326_1306295	Not Available	648	Open in IMG/M
3300010292\|Ga0126326_1308345	Not Available	644	Open in IMG/M
3300010292\|Ga0126326_1340781	Not Available	588	Open in IMG/M
3300010292\|Ga0126326_1393290	Not Available	513	Open in IMG/M
3300010292\|Ga0126326_1396127	Not Available	510	Open in IMG/M
3300010294\|Ga0126332_10034848	Not Available	2821	Open in IMG/M
3300010294\|Ga0126332_10043285	All Organisms → cellular organisms → Eukaryota	2564	Open in IMG/M
3300010294\|Ga0126332_10129999	Not Available	1393	Open in IMG/M
3300010294\|Ga0126332_10237509	All Organisms → cellular organisms → Eukaryota → Opisthokonta	867	Open in IMG/M
3300010294\|Ga0126332_10266300	All Organisms → cellular organisms → Eukaryota → Opisthokonta	780	Open in IMG/M
3300010294\|Ga0126332_10314038	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	666	Open in IMG/M
3300010295\|Ga0126334_10049471	Not Available	2283	Open in IMG/M
3300010295\|Ga0126334_10067356	Not Available	1969	Open in IMG/M
3300010295\|Ga0126334_10103798	All Organisms → Viruses → Predicted Viral	1557	Open in IMG/M
3300010295\|Ga0126334_10140081	Not Available	1291	Open in IMG/M
3300010295\|Ga0126334_10176147	Not Available	1098	Open in IMG/M
3300010295\|Ga0126334_10203644	Not Available	982	Open in IMG/M
3300010295\|Ga0126334_10251509	All Organisms → cellular organisms → Eukaryota → Opisthokonta	824	Open in IMG/M
3300010295\|Ga0126334_10268055	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	779	Open in IMG/M
3300010295\|Ga0126334_10344947	Not Available	621	Open in IMG/M
3300010295\|Ga0126334_10430178	Not Available	509	Open in IMG/M
3300010298\|Ga0126325_10025931	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2878	Open in IMG/M
3300010298\|Ga0126325_10068355	Not Available	1901	Open in IMG/M
3300010298\|Ga0126325_10152514	Not Available	1217	Open in IMG/M
3300010298\|Ga0126325_10173706	Not Available	1116	Open in IMG/M
3300010298\|Ga0126325_10248385	Not Available	862	Open in IMG/M
3300010298\|Ga0126325_10410739	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	572	Open in IMG/M
3300010298\|Ga0126325_10429180	Not Available	552	Open in IMG/M
3300010298\|Ga0126325_10473608	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	509	Open in IMG/M
3300010314\|Ga0126331_1032124	Not Available	2671	Open in IMG/M
3300010314\|Ga0126331_1061454	Not Available	1986	Open in IMG/M
3300010314\|Ga0126331_1084101	Not Available	1677	Open in IMG/M
3300010314\|Ga0126331_1098812	Not Available	1524	Open in IMG/M
3300010314\|Ga0126331_1187927	Not Available	965	Open in IMG/M
3300010314\|Ga0126331_1246084	Not Available	759	Open in IMG/M
3300010314\|Ga0126331_1257016	Not Available	729	Open in IMG/M
3300010314\|Ga0126331_1315068	Not Available	595	Open in IMG/M
3300010314\|Ga0126331_1333222	Not Available	561	Open in IMG/M
3300010314\|Ga0126331_1356733	Not Available	523	Open in IMG/M
3300010315\|Ga0136654_1033051	Not Available	2632	Open in IMG/M
3300010315\|Ga0136654_1046606	Not Available	2270	Open in IMG/M
3300010315\|Ga0136654_1081698	Not Available	1716	Open in IMG/M
3300010315\|Ga0136654_1124970	Not Available	1329	Open in IMG/M
3300010315\|Ga0136654_1222534	Not Available	862	Open in IMG/M
3300010315\|Ga0136654_1225212	Not Available	853	Open in IMG/M
3300010315\|Ga0136654_1243515	Not Available	795	Open in IMG/M
3300010315\|Ga0136654_1332459	Not Available	588	Open in IMG/M
3300010377\|Ga0126328_10008250	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Trichostrongyloidea	4293	Open in IMG/M
3300010377\|Ga0126328_10013704	Not Available	3668	Open in IMG/M
3300010377\|Ga0126328_10078618	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	1796	Open in IMG/M
3300010377\|Ga0126328_10126399	All Organisms → cellular organisms → Eukaryota	1362	Open in IMG/M
3300010377\|Ga0126328_10209130	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	947	Open in IMG/M
3300010378\|Ga0126330_10005892	Not Available	4807	Open in IMG/M
3300010378\|Ga0126330_10092872	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1638	Open in IMG/M
3300010378\|Ga0126330_10157482	Not Available	1173	Open in IMG/M
3300010378\|Ga0126330_10192080	Not Available	1014	Open in IMG/M
3300010378\|Ga0126330_10230207	Not Available	876	Open in IMG/M
3300010378\|Ga0126330_10394004	Not Available	540	Open in IMG/M
3300010378\|Ga0126330_10407792	Not Available	523	Open in IMG/M
3300011190\|Ga0126327_10059258	Not Available	1947	Open in IMG/M
3300011190\|Ga0126327_10068335	Not Available	1821	Open in IMG/M
3300011190\|Ga0126327_10191925	Not Available	985	Open in IMG/M
3300011190\|Ga0126327_10296621	Not Available	693	Open in IMG/M
3300011190\|Ga0126327_10331038	All Organisms → cellular organisms → Eukaryota → Opisthokonta	629	Open in IMG/M
3300011190\|Ga0126327_10417127	Not Available	509	Open in IMG/M
3300012273\|Ga0126329_10035789	Not Available	2527	Open in IMG/M
3300012273\|Ga0126329_10038770	Not Available	2445	Open in IMG/M
3300012273\|Ga0126329_10140010	Not Available	1271	Open in IMG/M
3300012273\|Ga0126329_10142420	Not Available	1257	Open in IMG/M
3300012273\|Ga0126329_10176206	Not Available	1089	Open in IMG/M
3300012273\|Ga0126329_10177518	Not Available	1083	Open in IMG/M
3300012273\|Ga0126329_10258061	Not Available	816	Open in IMG/M
3300012273\|Ga0126329_10276466	Not Available	770	Open in IMG/M
3300012273\|Ga0126329_10286506	Not Available	747	Open in IMG/M
3300012273\|Ga0126329_10319773	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	680	Open in IMG/M
3300012273\|Ga0126329_10321858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	677	Open in IMG/M
3300012273\|Ga0126329_10372450	Not Available	596	Open in IMG/M
3300012273\|Ga0126329_10411413	Not Available	547	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.01%
Environmental	Environmental	0.99%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	99.01%
Aquatic	Environmental → Aquatic	0.99%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	99.01%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.99%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	99.01%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.99%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F102263

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300010288	Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Tshipise hot spring metaG	Environmental	Open in IMG/M
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated	Open in IMG/M
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated	Open in IMG/M
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated	Open in IMG/M
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated	Open in IMG/M
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated	Open in IMG/M
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated	Open in IMG/M
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated	Open in IMG/M
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated	Open in IMG/M
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated	Open in IMG/M
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated	Open in IMG/M
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0116210_10979362	3300010288	Hot Spring	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMVERV*
Ga0126333_10172064	3300010290	Marine Gutless Worms	DGGEPGVDCRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126333_10186053	3300010290	Marine Gutless Worms	VVDEEKPGVDSRDEGKHAGRNDPLFVEKMMWMDERV*
Ga0126333_10612381	3300010290	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDERV
Ga0126333_10840992	3300010290	Marine Gutless Worms	VVDGGMKPGVDFRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126333_10958892	3300010290	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVDKMMWMDE*
Ga0126333_11644131	3300010290	Marine Gutless Worms	CVVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126333_11724371	3300010290	Marine Gutless Worms	VVDEGEPGVGDEGKHTGKNDPLFVEKMMWMGERV*
Ga0126333_12318321	3300010290	Marine Gutless Worms	VVDGGEPGVDFRDEGKHTGRNDLLFVKKMMWMGE*
Ga0126333_12782351	3300010290	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMYVDERL*
Ga0126333_12997122	3300010290	Marine Gutless Worms	VVDGEKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126326_10124464	3300010292	Marine Gutless Worms	VVGGEKLEVDFRDEGKHTGRNDLLFVEKMMWMDDREDEERVL*
Ga0126326_10132695	3300010292	Marine Gutless Worms	CVVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMPLITNC*
Ga0126326_10644902	3300010292	Marine Gutless Worms	VVGGGEPGVESRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126326_11543333	3300010292	Marine Gutless Worms	VADGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126326_12473082	3300010292	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLIFVEKMIWMDKQV*
Ga0126326_12632892	3300010292	Marine Gutless Worms	VIDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGER
Ga0126326_12960531	3300010292	Marine Gutless Worms	VVDEGKPGVDSRDEGKHTGRNDLLFVEKMMWMDEPV*
Ga0126326_13062951	3300010292	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVVKVMWMGERV*
Ga0126326_13083452	3300010292	Marine Gutless Worms	MVDGVKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126326_13407811	3300010292	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126326_13932901	3300010292	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGE*
Ga0126326_13961272	3300010292	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126332_100137893	3300010294	Marine Gutless Worms	VVDREKPGVDSRHEGKHTGRNDLLFVDKMMWMGERV*
Ga0126332_100348481	3300010294	Marine Gutless Worms	VVDEEKPGVDSRDEGKHAGRNDPLFVEKMMWMGERV*
Ga0126332_100432851	3300010294	Marine Gutless Worms	VVDEEKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126332_101299992	3300010294	Marine Gutless Worms	VDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDEQV*
Ga0126332_102375091	3300010294	Marine Gutless Worms	CVVDGGESGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126332_102663001	3300010294	Marine Gutless Worms	VDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126332_103140383	3300010294	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMSERV*
Ga0126334_100494712	3300010295	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMSERV*
Ga0126334_100673563	3300010295	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWVVLVLS*
Ga0126334_101037981	3300010295	Marine Gutless Worms	VIDGEKPGVDSRDEGKHTGRNDLLFVEKMMWMDKRV*
Ga0126334_101400811	3300010295	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFLEKMMWMDKQV*
Ga0126334_101761471	3300010295	Marine Gutless Worms	VVDGEKPGVDFRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126334_102036442	3300010295	Marine Gutless Worms	VVDGEKPGVDSRDEGKHTGRNDLLFVEKMMWMDEQV*
Ga0126334_102515091	3300010295	Marine Gutless Worms	DGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDKRV*
Ga0126334_102680552	3300010295	Marine Gutless Worms	CVVDGGEPGVDSRDEGKHTGRNDLLFVEKIMWIGERV*
Ga0126334_103449471	3300010295	Marine Gutless Worms	VVDGGVPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126334_104301781	3300010295	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV
Ga0126325_100259313	3300010298	Marine Gutless Worms	VVDGEKPGVDFRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126325_100683551	3300010298	Marine Gutless Worms	CVVDGAEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126325_101525143	3300010298	Marine Gutless Worms	DGGEPGVDSRDEGKHTGRNDLLFVQKMMWMGERV*
Ga0126325_101737061	3300010298	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGEGV*
Ga0126325_102483851	3300010298	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126325_104107392	3300010298	Marine Gutless Worms	VDGGKPGVGFRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126325_104291801	3300010298	Marine Gutless Worms	CVVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126325_104736081	3300010298	Marine Gutless Worms	CVVDGREPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126331_10077546	3300010314	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLLVDKMMWMDKRV*
Ga0126331_10321244	3300010314	Marine Gutless Worms	VADGEKPGVDSRDEGKHTGRNDLLFVEKMMWMGELV*
Ga0126331_10614541	3300010314	Marine Gutless Worms	DGGEPGVDSRDEGKHTGRNDLLFVEKMMWMSERV*
Ga0126331_10841011	3300010314	Marine Gutless Worms	DEGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126331_10988121	3300010314	Marine Gutless Worms	VVDGEKPGVDFRDEGKHTGRNDLLFAEKMMQMDE*
Ga0126331_11879272	3300010314	Marine Gutless Worms	VVDEEKPGVDSRDEGKHTGRNDPLFVEKMMWMGERV*
Ga0126331_12460841	3300010314	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMGMGERV*
Ga0126331_12570161	3300010314	Marine Gutless Worms	VVGGGEPGVDFRDEGKNTGRNDLLFVEKMMWMDERV*
Ga0126331_13150682	3300010314	Marine Gutless Worms	VLDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV
Ga0126331_13332222	3300010314	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMHWMGE*
Ga0126331_13567331	3300010314	Marine Gutless Worms	DGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDEQV*
Ga0136654_10330512	3300010315	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGVV*
Ga0136654_10466061	3300010315	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDERA*
Ga0136654_10816981	3300010315	Marine Gutless Worms	VVDRRKPGVDSRDEGKHTGKNDLLFVQKMMWIDERV*
Ga0136654_11249701	3300010315	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV
Ga0136654_12225342	3300010315	Marine Gutless Worms	LCVVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0136654_12252123	3300010315	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVHVEKMMWMGERV*
Ga0136654_12435151	3300010315	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGDVTSWH*
Ga0136654_13324592	3300010315	Marine Gutless Worms	AGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126328_100082503	3300010377	Marine Gutless Worms	VVEGGEPGVDFRDEGKHTGRNDLLFVEKMMWMGE*
Ga0126328_100137041	3300010377	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWTGERL*
Ga0126328_100786181	3300010377	Marine Gutless Worms	MADGEKPGVDSRDEGKHTGRNDLLFVEKMMWMVERV*
Ga0126328_101059392	3300010377	Marine Gutless Worms	MVDGGKPGVGFRDEGKHTGMNDLLFVEKMMWMDERV*
Ga0126328_101263992	3300010377	Marine Gutless Worms	CVVDEEKPGVDSRDEGKHTGRNDLLFVEKMMWMD*
Ga0126328_102091302	3300010377	Marine Gutless Worms	CVVDGGEPGVDFRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126330_100058922	3300010378	Marine Gutless Worms	VVDEGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126330_100284772	3300010378	Marine Gutless Worms	MVDGGKPGVDSGDEGKHTGRNDLLFVEKMMRMAEQV*
Ga0126330_100928724	3300010378	Marine Gutless Worms	MVDGGKPGVDFRYEGKHTERNDMLFIEKMMWVDERR*
Ga0126330_101280932	3300010378	Marine Gutless Worms	MVDGGKPGVGSRDEGKYTGRNDLLFVEKMMWMDERV*
Ga0126330_101574822	3300010378	Marine Gutless Worms	VDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMDERL*
Ga0126330_101920801	3300010378	Marine Gutless Worms	CVVDGGEPGVDSRDEGKHTGRNDLLFVEKMMLNKT*
Ga0126330_102302071	3300010378	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126330_103940043	3300010378	Marine Gutless Worms	MVDGAEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126330_104077922	3300010378	Marine Gutless Worms	VVNGGKPGVDSRDEGKHTGRNDLLFVEKMMWTDERV*
Ga0126327_100592584	3300011190	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVDKMTWMGEGV*
Ga0126327_100683351	3300011190	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMWTDERV*
Ga0126327_101919251	3300011190	Marine Gutless Worms	VVDGRKPGIYSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126327_102966211	3300011190	Marine Gutless Worms	VVDEEKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV
Ga0126327_103310381	3300011190	Marine Gutless Worms	VVGGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGEGV*
Ga0126327_104171271	3300011190	Marine Gutless Worms	MQNWRDKCVVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWTDERV*
Ga0126329_100357894	3300012273	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRSGLLFVEKMMWVDQ*
Ga0126329_100387703	3300012273	Marine Gutless Worms	VEGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_101400101	3300012273	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKIMWIDEHV*
Ga0126329_101424202	3300012273	Marine Gutless Worms	VVDGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGER
Ga0126329_101762063	3300012273	Marine Gutless Worms	VVDREKPGVDFRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_101775182	3300012273	Marine Gutless Worms	DGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_102580612	3300012273	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFLEKMMWTGERM*
Ga0126329_102764661	3300012273	Marine Gutless Worms	VDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_102865061	3300012273	Marine Gutless Worms	MVDGGKPGVDSVDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_103197732	3300012273	Marine Gutless Worms	VVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMDERV*
Ga0126329_103218582	3300012273	Marine Gutless Worms	MVDGGKPGVDSRDEGKHTGRNDLLFVEKMMWMGKRV*
Ga0126329_103724501	3300012273	Marine Gutless Worms	VVYGGEPGVDSRDEGKHTGRNDLLFVEKMMWMGERV*
Ga0126329_104114131	3300012273	Marine Gutless Worms	VDGGKPGVDSRDEGKHTGRNDLLFVQKMMWMGERV*

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign