NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102408

Metagenome Family F102408

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102408
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 72 residues
Representative Sequence MAIFHFPQFEHEPFWRYLSRLNYYRAQYVLFMYEKWEICDVVLEGITHETRATLESMCYGGLCLLNVDDM
Number of Associated Samples 9
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.04 %
% of genes near scaffold ends (potentially truncated) 49.50 %
% of genes from short scaffolds (< 2000 bps) 93.07 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.089 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(72.277 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.20%    β-sheet: 0.00%    Coil/Unstructured: 39.80%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.08 %
UnclassifiedrootN/A7.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006020|Ga0058704_10034082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2518Open in IMG/M
3300006020|Ga0058704_10096001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1569Open in IMG/M
3300006020|Ga0058704_10120033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1416Open in IMG/M
3300006020|Ga0058704_10291272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha931Open in IMG/M
3300006020|Ga0058704_10523798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha694Open in IMG/M
3300006020|Ga0058704_10632213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha630Open in IMG/M
3300006020|Ga0058704_10890423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → unclassified Streptococcus → Streptococcus sp. HSISS3527Open in IMG/M
3300006020|Ga0058704_10909972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha521Open in IMG/M
3300006020|Ga0058704_10955571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha507Open in IMG/M
3300006020|Ga0058704_10979979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha501Open in IMG/M
3300009144|Ga0058702_10084438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1202Open in IMG/M
3300009144|Ga0058702_10171972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha843Open in IMG/M
3300009144|Ga0058702_10204985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha774Open in IMG/M
3300009144|Ga0058702_10238526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha719Open in IMG/M
3300009144|Ga0058702_10246879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha707Open in IMG/M
3300009144|Ga0058702_10252519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha700Open in IMG/M
3300009144|Ga0058702_10490174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha512Open in IMG/M
3300009144|Ga0058702_10499053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha508Open in IMG/M
3300010395|Ga0058701_10133825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1818Open in IMG/M
3300010395|Ga0058701_10184128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1433Open in IMG/M
3300010395|Ga0058701_10188611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1407Open in IMG/M
3300010395|Ga0058701_10193222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1382Open in IMG/M
3300010395|Ga0058701_10212742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1285Open in IMG/M
3300010395|Ga0058701_10222320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1243Open in IMG/M
3300010395|Ga0058701_10239763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1174Open in IMG/M
3300010395|Ga0058701_10339023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha907Open in IMG/M
3300010395|Ga0058701_10344609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha896Open in IMG/M
3300010395|Ga0058701_10346429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha892Open in IMG/M
3300010395|Ga0058701_10363860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha861Open in IMG/M
3300010395|Ga0058701_10405123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha797Open in IMG/M
3300010395|Ga0058701_10414491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha784Open in IMG/M
3300010395|Ga0058701_10439832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha752Open in IMG/M
3300010395|Ga0058701_10465710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha722Open in IMG/M
3300010395|Ga0058701_10472972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha715Open in IMG/M
3300010395|Ga0058701_10477900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha710Open in IMG/M
3300010395|Ga0058701_10556300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha642Open in IMG/M
3300010395|Ga0058701_10557404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha641Open in IMG/M
3300010395|Ga0058701_10560776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha638Open in IMG/M
3300010395|Ga0058701_10570512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha631Open in IMG/M
3300010395|Ga0058701_10582900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha623Open in IMG/M
3300010395|Ga0058701_10598544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha612Open in IMG/M
3300010395|Ga0058701_10600188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha611Open in IMG/M
3300010395|Ga0058701_10635787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha590Open in IMG/M
3300010395|Ga0058701_10645247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha584Open in IMG/M
3300010395|Ga0058701_10698952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha557Open in IMG/M
3300010395|Ga0058701_10704144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha554Open in IMG/M
3300010395|Ga0058701_10713713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha550Open in IMG/M
3300010395|Ga0058701_10717836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha548Open in IMG/M
3300010395|Ga0058701_10758181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha531Open in IMG/M
3300010395|Ga0058701_10761247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha530Open in IMG/M
3300010395|Ga0058701_10763486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha529Open in IMG/M
3300010395|Ga0058701_10767938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha527Open in IMG/M
3300010395|Ga0058701_10799626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha515Open in IMG/M
3300010395|Ga0058701_10815601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha509Open in IMG/M
3300010395|Ga0058701_10836057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha502Open in IMG/M
3300010395|Ga0058701_10836080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha502Open in IMG/M
3300010395|Ga0058701_10838237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha501Open in IMG/M
3300027718|Ga0209795_10080611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha945Open in IMG/M
3300027809|Ga0209574_10020924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1494Open in IMG/M
3300030495|Ga0268246_10057335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1136Open in IMG/M
3300030495|Ga0268246_10102006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha840Open in IMG/M
3300030495|Ga0268246_10162764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha659Open in IMG/M
3300030495|Ga0268246_10237880All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha545Open in IMG/M
3300030498|Ga0268247_10053243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1687Open in IMG/M
3300030498|Ga0268247_10070976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1502Open in IMG/M
3300030498|Ga0268247_10219404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha881Open in IMG/M
3300030498|Ga0268247_10223444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha872Open in IMG/M
3300030498|Ga0268247_10289612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha755Open in IMG/M
3300030498|Ga0268247_10306216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha731Open in IMG/M
3300030498|Ga0268247_10315251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha719Open in IMG/M
3300030498|Ga0268247_10345179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha682Open in IMG/M
3300030498|Ga0268247_10347822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300030498|Ga0268247_10357805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha668Open in IMG/M
3300030498|Ga0268247_10367290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha658Open in IMG/M
3300030498|Ga0268247_10371035Not Available654Open in IMG/M
3300030498|Ga0268247_10372161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha653Open in IMG/M
3300030498|Ga0268247_10458722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha577Open in IMG/M
3300030498|Ga0268247_10490224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha554Open in IMG/M
3300030498|Ga0268247_10503988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha545Open in IMG/M
3300030498|Ga0268247_10509686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha542Open in IMG/M
3300030498|Ga0268247_10530590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha529Open in IMG/M
3300030501|Ga0268244_10034387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2015Open in IMG/M
3300030501|Ga0268244_10117714Not Available1221Open in IMG/M
3300030501|Ga0268244_10136058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1150Open in IMG/M
3300030501|Ga0268244_10176535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1031Open in IMG/M
3300030501|Ga0268244_10212355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha953Open in IMG/M
3300030501|Ga0268244_10239042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha905Open in IMG/M
3300030501|Ga0268244_10256720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha878Open in IMG/M
3300030501|Ga0268244_10292038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha830Open in IMG/M
3300030501|Ga0268244_10311758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha806Open in IMG/M
3300030501|Ga0268244_10383713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha735Open in IMG/M
3300030501|Ga0268244_10410408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha713Open in IMG/M
3300030501|Ga0268244_10457498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha679Open in IMG/M
3300030501|Ga0268244_10601139Not Available599Open in IMG/M
3300030501|Ga0268244_10815423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha519Open in IMG/M
3300030505|Ga0268245_10322922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha503Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave72.28%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave27.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006020Agave microbial communities from Guanajuato, Mexico - Mg.Sf.eHost-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030501Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030505Agave microbial communities from Guanajuato, Mexico - Mg.Ma.e (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058704_1003408243300006020AgaveMAIFYLPQFKHEPFWQYLSWLNDYRAQYVHVTYEEWEICDVVLEGITLETRAILESLYYDGLCSLDVDDM*
Ga0058704_1006664313300006020AgaveIFHFSQFEHESFCQYLSILNDYRAQYVLFMYEKLEICEVVLEGITHETRATLDSMCYGSFCSLTFYDMWDLFKLLPYHQW*
Ga0058704_1009600123300006020AgaveMAIFHFPQFEHEPFWQYLSWFNDYRTQYMHFTYEKWEICDAVLEGITHETRAILESMCYGDLCSLDVDDMWDLFESLAWHQ*
Ga0058704_1012003323300006020AgaveMAIFHFPQFEHEPFCQYLSSLNDYRIQYMHFEYEKWEICDVVLEGITHETRATLESMCYGGMYSLDVDAM*
Ga0058704_1029127213300006020AgaveMAIFHLPQFEHKPFCQYLSRFNDYHAQYVHFTYEKRGICDVVLEGITHETRTILES
Ga0058704_1051942423300006020AgaveMAIFHLPQFEHELFWHYLSRLNDYRAQYMLFEYAKWEIYDVVLEGITHETRATLESCVMVVYVL*
Ga0058704_1052379823300006020AgaveQYLSRLNDYRAYYVLFEYENWEICDIVLQGITHKTRITLESMCYGGLCSLDVDGMWDLFESLAWY*
Ga0058704_1063221333300006020AgaveHEPFWQYLSRFNDYRTHYVHFTYEKWKIYDVVLDGITHETRATLECMCYGGMCFLDVDDLWDLFESLAWS*
Ga0058704_1086907213300006020AgaveMAIFHLPRFEHELFWHYLSRLNDYHAQYLLFEYEKWEIYDVVLKGITPETRATLSPYVMVVCVP*
Ga0058704_1089042313300006020AgaveMAIFRIPQFEHEPFWQYLSRLNDHRTQYVLFECEKWEICNVVLERITHEARAILESMCYGGMCFL
Ga0058704_1090997223300006020AgaveMAIFHFPQFEHEPFWQYLSHLNDYRAQYVHFTYEKWEICNVVLQRITHETRATLESMCYGGLCYLDVDFM*
Ga0058704_1095557123300006020AgaveMAIVHFPQFEYEPFWQYLSRFNHYHAQYMQFTYEKWEICDAVLEGITHETRATLESMCYGGLCSLDVDDMWDLFESL
Ga0058704_1097997913300006020AgaveMAIFHSSQFEHEHFWQYLSRLNDYRAQYVRFTYEKWEICNVVHEGITYETRATLESMCYGGMCSLDVNDMCDLFESLAWYQ*
Ga0058702_1008443813300009144AgaveMTIFHLPQFEHEPFWRYLSQLNDYHAQYVHFVYDKWETCDVLLEGITYDTRATLESMCYSGLDSLNADDMWNLFDL*
Ga0058702_1017197213300009144AgaveMTIFHLPQFQHKPFWQYLSRLNDYRAQYVHLMYEKWEIYNVMLEGITHETRATLECMCYGGLCSLNADDMWDLF*
Ga0058702_1020498513300009144AgaveMDIFHLPQFEHEPFLQYLSRLNDYRAQYVQFVYSKWEICDILLEGVTYETRGMLESMCYRGLDSLNADDMWDLFESLASYQ
Ga0058702_1023852613300009144AgaveMAIFHLPQFDREPFRQYLSRLNDYHAQYVHFMFEKWEICNAVLESIIHKTRAILETMCYGGLGS*
Ga0058702_1024687913300009144AgaveHEPFWQYLSRLNNYHAQYVHFMYEKRELCDVVIKGITHETRAIVESMCYGSLCSLNVDDI
Ga0058702_1025251913300009144AgaveMVIFHLSQFKHEHFWQCLSRLNDYHAKYVLFMDEKWQICNVVLEGITYETQAIHESMCYAGLRSLYVDDMWDLF*
Ga0058702_1049017413300009144AgaveMAIFHFSQFEHEPFWQYLSRLNDYRAQYAHSMFAKWEICEIVLEGITHETRATLESMCYGGLYSLNVDDMW
Ga0058702_1049905313300009144AgaveMAVSHFPQFEHEPFWQYLSRLNDYRAQYVLSMYEKWEICDVMLEGITHETRATLESMCY
Ga0058701_1008263343300010395AgaveLKNQLKILKIIKMGIFYLSQFKYKPFWQYLSRLNDYHAQYVHFMYEKWKIYDVLEGITYETRATLESCIMVVCAL*
Ga0058701_1013382513300010395AgaveMVVFHLPQFEHEPFWQYLSILNDYHAQYVHFIYEKWEICNVVLKGIKHETRATLKSCYDGMCYLSVHDM*
Ga0058701_1018412813300010395AgaveMSIFYLPQFEHEPFGRYLSILNDYRAQHVHFMYEKWEICNDVLEGIAYEARATLESMCYGGLCSLDVDNI*
Ga0058701_1018861113300010395AgaveMVIFHLPQSEHEPFWQYFSRLNDYRAQYVHFMYEKWEICDVVLEGVTYETQATLESMCYNTLGSLNADDIWDLFESLASYQ*
Ga0058701_1019322213300010395AgaveMVIFHLPQFEHEPFRQYLSRLNDYHAQYVHFMYEKWEICNVVLEGITHETRTTLESMCYGGLCSSNVDGM*
Ga0058701_1021274223300010395AgaveMAIFHFPQFQHESFWQYLSRLNDYRAQYVHFMYEKWEICDVVLEGITCETRATLESMCYGGLCSLNVDDMWNLFEYLASSQ*
Ga0058701_1022232023300010395AgaveVAIFHLPQFEHEPFWQYLSRLNDYRAQYMHFIYEKWKIRNVVLVGITHETRFTLESYVGGLSSLNVDDTWNLFEPLASYP*
Ga0058701_1023976313300010395AgaveMAIFHLPQFEHEPFRLYLSRLNDYCAQCVHFMYEKWEICDVVLQGVTHETRANLESMCYCGLCSLNVDDM*
Ga0058701_1033902313300010395AgaveMVVFHFPQFKHEPFWQYLSRLNDYRAQYMLFMYNKWEICDVFLEGMTYETRAMLETACYRGLDSLHADEMWDLFESSFLPMAMGVFQ*
Ga0058701_1034460913300010395AgaveVAIFHFPQFRHEPFWQYLSRLNDYRAQYVPSMYENWEICDVVLEEITHKTRATLESMCYGGYCSLNADDMWNLFESLASYQ*
Ga0058701_1034642913300010395AgaveMAIFHFPQFEHEPFRQYLSRLNDYRAQYAHSVLEKSKICDVVLEGITHEPRATLESMCYGSLCSLNIDDMWNLFEYLASYQW*
Ga0058701_1036386013300010395AgaveMAIFHLLQFEHEPFWHYLSRLNDYRAQYVQFVYNKWEICDVLLEGMTYGTRAMLESMCYRGLDSVNADDMWNLFESLASY*
Ga0058701_1040512313300010395AgaveMAIFHLPQFEHEPFWQYLSRLNDYRAQYVQFVYNKWEICDVLLEGMTYETRAMLESMCYRGLDSLNADD
Ga0058701_1041449113300010395AgaveMAIFHLPQFEHEPFWQYLSRLNDYRARYVHFMYEKWKICNVVLKGVTYETQATLESMCYNRLGSLNA
Ga0058701_1043983233300010395AgaveFPQFEHEPFWQYLSRLNDYRAQYVLSMYEKWEICDVMLAGLTYETRASLEPICYGSLCSLNADDM*
Ga0058701_1046571013300010395AgaveMAIFHFPQFEHEPFWQYLSRLNDYHAQYVHSLFEKWEICDVMLERITPETRATLESMCYGGLCSLNADDMWDLFESLASYQ*
Ga0058701_1047297213300010395AgaveMAIFHFPQFEHGPFWQYLFRLNDYRAQYVHSMYEKWEICEVVLEDITHETRAILESSCCGGLYFL
Ga0058701_1047790013300010395AgaveMAIFHFSQFEHETFWQYLSRLNDNRAQYVLSMYEKWEICDVVLEGITHETRATLES
Ga0058701_1055630033300010395AgaveLFFILPQFEHEPFWQYLSRLNDYHSKYAHFMYEKWEICDIVLEGITHETQATLESMCYGGLCSLNVDDM*
Ga0058701_1055740413300010395AgaveMAIFHFPQFEHELFWQYLFRLNDYRAQYVLSMYEKWEICNVMLAGITHETRANLESMCYGGLCLLNADDMWDLFESLASYQ
Ga0058701_1056077613300010395AgaveMAVFHFFQFEHEPFWQYLSRLNDYRAQYMLFMYNKWEICDVLLEGITHETRATLESMCYGGLC
Ga0058701_1057051213300010395AgaveMAIFHFPQFEHESFWQYLSRLNDYRAQNVLSMYNKWEICDVMLEGITHETRATLESMCYGGLC
Ga0058701_1058290013300010395AgaveMAIFYFSQFEHEPFWQYLSRLNDYRAQYVHSMFDKWEICDVMLKGITHETRATLESMCYGGLCSLNADDMWDLFESLASYQWH
Ga0058701_1059854413300010395AgaveMTIFHLPQFERERFWQYLSRLNDYRAQYVHFMYDKWEIYDVLLEEITYDTRATLKSMCYSGLDSLNADDMWDLF*
Ga0058701_1060018813300010395AgaveMKEKKTKTKQKDKKMAIFHVPQFEHEPLWQYLSRLSDYSAQYVQFVYNKWKICDVLLEGMTYETRAMLESMCYRGLDSLNADDMWDLFESL
Ga0058701_1063578713300010395AgaveMAVFHFPQFEHESFWQYLSRLNDYRSQYVLSMYEKWEVCDVMLERITHETRATLESMCYGGLCLLNADDMWDLFESLASYQWNCE
Ga0058701_1064524713300010395AgaveMAIFHFPQFEHEPFWQYLSRLNDYRTQYVHSMFEKWEICDVMLEGITHETRATLESMCYG
Ga0058701_1069895213300010395AgaveMAIFHLAKFEHESFRQYLCRLNDYRAQYVHFMYQKWEICDVVLEGMTHETQATLKPLCYGGLCSLNVDDM*
Ga0058701_1070414413300010395AgaveMAIFHFFQFEHEPFWQYLSRLNDYHAQYVHSMFEKWEICDVMLERITHETRATLESMCYGGLCSLNADDMWDLFESLASYQWH
Ga0058701_1071371313300010395AgaveMVVFHLPQFEHESFWQYFSRLNDYRAQYVHFMYETWEICDVVLKGITYETQASLESMCYNRLGCLNADDM*
Ga0058701_1071783613300010395AgaveLAIFHFPQFEHEPFWQYLSRLNDYRAQYVRSMFEKWKICDVMLEGITHEIRATLESMCYGGLCSLNADDMW
Ga0058701_1075818113300010395AgaveMAVFHFPQFEHEPFWQYLSRLNDYRAQYMLFMYDKWEICYVMLEGITHETRATLESMCYGGLCLLNADDMWDLFES
Ga0058701_1076124713300010395AgaveIFHLPQFEHEPFWQYLFRLNDYVAQYVHFMYEKWERCNVVLEGITHETQATLESMCCGGLFSLNDDDMWDLFESFTSYQW*
Ga0058701_1076348613300010395AgaveMAIFHFPQFEHEPFWQYLSRLNDYHAQYMHSMFEKWEICEVMLEGITHETRATLESMCYSGLCSLNAD
Ga0058701_1076793823300010395AgaveMAIFHFAQFEREPFWQYLSRLNDYRAQFGHSMFEIWEICDIMLAGITHETRATLEPICYGGLCSLNADDMWDLFESLASY*
Ga0058701_1079962613300010395AgaveLKSQKKKKSIKMAIFYLPQFEQEPFWQYFSSLNDYRAQYVHFMYEKWEICDVVLKATTYETQATLESMCYNRLVSLNADDM*
Ga0058701_1081560113300010395AgaveMAIFHFPQFEHEPIWQYLSRLNDYRAQYAYAMFKKWEICNVVLEGITHETRAILDSLCYGGLYSLNVDDM*
Ga0058701_1083605713300010395AgaveMAIFHFPQFEHEPFWQYLSRLNDHRAQYMLFMYDKWEICDVMLEGITHETRVALESMCYGGLCLLNADDMWDLFES
Ga0058701_1083608013300010395AgaveMVVFHFPQFEHEFFWQYLSRLNDYRAQYMLFMYNKWEICDVQLEGMTYETRAMLESMCYRGLDSLNADDMWDLFES
Ga0058701_1083823713300010395AgaveMAIFHFSQFEHESFWQYLSRLNYYHAQYAHSMFAKWEICEVVLEGITHETRATLESMCY
Ga0209795_1008061113300027718AgaveMAIFHFPQFENEPFLQYLSRLNDYRAQYVLSMYEKWEICDVVLEGITHETRTTLESMCYGGLCSLNADD
Ga0209574_1002092423300027809AgaveMAIFHFPQFEHEPFCQYLSSLNDYRIQYMHFEYEKWEICDVVLEGITHETRATLESMCYGGMYSLDVDAM
Ga0268246_1005733513300030495AgaveMTIFHLPQFEHEPFWRYLSQLNDYHAQYVHFVYDKWETCDVLLEGITYDTRATLESMCYSGLDSLNADDMWNLFDL
Ga0268246_1010200613300030495AgaveMTIFHLPQFQHKPFWQYLSRLNDYRAQYVHLMYEKWEIYNVMLEGITHETRATLECMCYGGLCSLNADDMWDLF
Ga0268246_1016276413300030495AgaveMAIFYFPEFEHEPLWQYLSRLNDYCAQYVLSMYEKWEICDVVLEGITHETRATLESM
Ga0268246_1023788013300030495AgaveMVIFHLSQFKHEHFWQCLSRLNDYHAKYVLFMDEKWQICNVVLEGITYETQAIHESMCYAGLRSLYVDDMWDLF
Ga0268247_1005324313300030498AgaveMAIFYFPQFEHEPFWQYLSRLNDYRAQYVHSMCEKWEICDVALKGITHETRATLESMCYGGLCSLNADDM
Ga0268247_1007097613300030498AgaveMAIFHFPQFQHESFWQYLSRLNDYRAQYVHFMYEKWEICDVVLEGITCETRATLESMCYGGLCSLNVDDMWNLFEYLASSQ
Ga0268247_1021940413300030498AgaveMAIFHFAQFEREPFWQYLSRLNDYRAQFGHSMFEIWEICDIMLAGITHETRATLEPMCYGGLCSLNADDMWDLFESLASY
Ga0268247_1022344413300030498AgaveMAIFHFPQFEHEPFRQYLSRLNDYRAQYAHSVLEKSKICDVVLEGITHEPRATLESMCYGSLCSLNIDDMWNLFEYLASYQW
Ga0268247_1028961213300030498AgaveMAIFHLPQFEHEPFWQYFSXLNDYRAQYVHFMYEKWEIYDVVLKGITYETQATLESMCYSGLGSLNTHNMWDLFESLA
Ga0268247_1030621613300030498AgaveMAIFHFPQFEHEPFWQYLSRLNDYHAQYVHSMYEKWEIRDVVLKGTTHETRTTLES
Ga0268247_1031525123300030498AgaveMVIFHLPQFEHEPFWQYLFRLNDYVAQYVHFMYEKWERCNVVLEGITHETQATLESMCCGGLFL
Ga0268247_1034517913300030498AgaveMAIFHFPQFEHEPFWRYLSRLNYYRAQYVLFMYEKWEICDVVLEGITHETRATLESMCYGGLCLLNVDDM
Ga0268247_1034782213300030498AgaveMVIFHFPQYEHEPFWQYLSRLNDYRAQFAHSMFEKWEICEVVLEGITHETRATLESMCYGGLCSL
Ga0268247_1035780523300030498AgaveMAIFYFPQFEHEPLWQYLSRLNDYCAQYVLSMYEKWEICDVVLEGITHETRATLESMCYGGLCLLNADDM
Ga0268247_1036729013300030498AgaveVAIFHFPQFRHEPFWQYLSRLNDYRAQYVPSMYENWEICDVVLEEITHKTRATLESMCYGGYCSLNADDMWNLFESLAS
Ga0268247_1037103513300030498AgaveMAIFHLPQLQPESFWQYLFRLNDYHAQYVHFTYEKQEICNVVLEGATYESQATLKSMCCRGNSFMCSSPPP
Ga0268247_1037216113300030498AgaveMAIFHFPQFEHEPFWQYLSRLNDYRAQYVHSMYVKSEICNVVLEGITHETRATLESMCCGGFCLL
Ga0268247_1045872213300030498AgaveVAIFHFPQFEHEPFWQYLSPLNDYRAEYAQSMFEKREICDVVLKGIIHETRATLESMCYGGLCPLIVDNMWDLFEYLA
Ga0268247_1049022413300030498AgaveMAIFHFPQFEHEPIWQYLSRLNDYRAQYAYAMFKKWEICNVVLEGITHETRAILDSLCYGGLYSLNVDDM
Ga0268247_1050398813300030498AgaveMAIFHFPQFEHEPFWQYLSRLNNYRAQYVHSIYEKRGICDVVLEGITHETRATLESM
Ga0268247_1050968613300030498AgaveMAIFHLPQFEHEPFWQYLSRLNDYRARYVHFMYEKWKICNVVLKGVTYETQATLESMCYNRLGSLNADDI
Ga0268247_1053059013300030498AgaveMSIFYLPQFEHESFWQYLSRLNDYRTQYVHFMYEIWEICNVVLEGITHETRATLESMCYGGLCSLNVDDM
Ga0268244_1003438723300030501AgaveMAIFYLPQFKHEPFWQYLSWLNDYRAQYVHVTYEEWEICDVVLEGITLETRAILESLYYDGLCSLDVDDM
Ga0268244_1011771443300030501AgaveHELIWQYLFALTDYHAQCVYVTYEKWEICNVVLKGITNETRATLESMCSSYLCSLNVDAS
Ga0268244_1013605813300030501AgaveMAIFHLPQFEHKPFCQYLSRFNDYHAQYVHFTYEKRGICDVVLEGITHETRTILESLCYGGLCSLD
Ga0268244_1017653513300030501AgaveKKYIKITIFHFFQLEHELFWQYLSRLNNYRAQYVHFTFKKWGICDVVLEGITHAARAFLESMHYGGMCYLGVDDK
Ga0268244_1021235513300030501AgaveMAIFNLPQFKHESFWHCLSRLNDYCAQYGLFEYDKWEICKVVLERITQETRAILESMS
Ga0268244_1023904213300030501AgaveMAIFHFPQFEHELFWQYLSQFNDYRAQYMHFTYEKWEICDAVLEGITHETRAILESMCYGDLCSLDVDDMWDLFESLAWHQ
Ga0268244_1025672013300030501AgaveMAIFHFPQFEHEPFWQYLSHLNDYRAQYVHFTYEKWEICNVVLQRITHETRATLESMCYGGLCYLDVDFM
Ga0268244_1029203813300030501AgaveMAIFHLPRFEHELFWHYLSRLNDYHAQYLLFEYEKWEIYDVVLKGITPETRATLESICYGGLCSLDVDDM
Ga0268244_1031175813300030501AgaveMTIFHLPQFEHEPFWHYLSKLNDYRAQYVLFEYEKWEICDAMLEGITPETRAILGSMCYGGLYSLAV
Ga0268244_1038371313300030501AgaveMAIFHFPQFEHGPFWQYLYRLNDYYAQYVHFTYEKWKICNAMLKGITHETQATLESICYGGLCYLIVDDM
Ga0268244_1041040813300030501AgaveMAIFHFPQFEHEPFWQYLSRFNNYRAQYVHFTYEKWEICDTVLEGITHETRTTLESMCYGGMCYLDADDMWDLFESLAWY
Ga0268244_1041189413300030501AgaveMAIFHLPQFEHELFWHYLSRLNDYRAQYMLFEYAKWEIYDVVLEGITHETRATLESCVMVVYVL
Ga0268244_1045749813300030501AgaveMAIFHLPQFEHESFWQYLSRLNDYRAQYVHFTYEKWEICNVVLERLTHETRTILESMCYGGLCSLHVDDM
Ga0268244_1060113913300030501AgaveLKKKFEMTILYVPQFEYEPFWQYWFRLNDYRAQYVYFTYEKWEICNAVLEEITHETQATLESMCYGDLCFLDDDMWDLFESLTWYQW
Ga0268244_1081542313300030501AgaveMAIFHLSQSEHEPFWRYLSWLNDYRAQYVHFAYEKWKICDVVLEEITPETRAILESMCYGGLRSLTDDDMWDLFESLAWHQWQS
Ga0268245_1032292213300030505AgaveMAIFHFPQFEHEPFWQYLSRFNDYRAQYVHFTYEKWEVCDAVLEGVTHETRAILESMCY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.