NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102419

Metagenome / Metatranscriptome Family F102419

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102419
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 154 residues
Representative Sequence MQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQAGSSNRSDRPGDRPRTFKPKHPEVGTWKTNEVKVQGRTANQKPTFNQL
Number of Associated Samples 72
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.95 %
% of genes near scaffold ends (potentially truncated) 82.18 %
% of genes from short scaffolds (< 2000 bps) 99.01 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (84.158 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(79.208 % of family members)
Environment Ontology (ENVO) Unclassified
(92.079 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(69.307 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.35%    β-sheet: 11.41%    Coil/Unstructured: 84.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03732Retrotrans_gag 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.08 %
UnclassifiedrootN/A7.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005615|Ga0070702_101151326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii622Open in IMG/M
3300005841|Ga0068863_102749351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Kaistia → Kaistia adipata500Open in IMG/M
3300009101|Ga0105247_11270180All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii590Open in IMG/M
3300009177|Ga0105248_11305778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii821Open in IMG/M
3300009553|Ga0105249_13305828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300009981|Ga0105133_116658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300009989|Ga0105131_126818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300009994|Ga0105126_1054187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii512Open in IMG/M
3300009995|Ga0105139_1090746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300009995|Ga0105139_1095127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii570Open in IMG/M
3300009995|Ga0105139_1109838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300009995|Ga0105139_1113032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii526Open in IMG/M
3300010371|Ga0134125_12622793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300014968|Ga0157379_12411562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii525Open in IMG/M
3300015273|Ga0182102_1022191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii617Open in IMG/M
3300015278|Ga0182099_1049924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii564Open in IMG/M
3300015280|Ga0182100_1079468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii546Open in IMG/M
3300015290|Ga0182105_1038677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii715Open in IMG/M
3300015290|Ga0182105_1084620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis551Open in IMG/M
3300015290|Ga0182105_1093055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015293|Ga0182103_1024638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300015293|Ga0182103_1072964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii567Open in IMG/M
3300015297|Ga0182104_1024868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii854Open in IMG/M
3300015311|Ga0182182_1115058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii514Open in IMG/M
3300015312|Ga0182168_1022053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae955Open in IMG/M
3300015313|Ga0182164_1103061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii563Open in IMG/M
3300015313|Ga0182164_1126815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii519Open in IMG/M
3300015315|Ga0182120_1034092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii840Open in IMG/M
3300015315|Ga0182120_1069445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300015317|Ga0182136_1093899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015317|Ga0182136_1119754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300015320|Ga0182165_1082638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii632Open in IMG/M
3300015320|Ga0182165_1097993Not Available592Open in IMG/M
3300015327|Ga0182114_1098427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015327|Ga0182114_1127125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii557Open in IMG/M
3300015328|Ga0182153_1029461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii905Open in IMG/M
3300015328|Ga0182153_1057738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis725Open in IMG/M
3300015328|Ga0182153_1143882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015329|Ga0182135_1080524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis650Open in IMG/M
3300015330|Ga0182152_1149215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015331|Ga0182131_1087220Not Available635Open in IMG/M
3300015331|Ga0182131_1125798Not Available549Open in IMG/M
3300015333|Ga0182147_1145697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum536Open in IMG/M
3300015337|Ga0182151_1114863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii585Open in IMG/M
3300015337|Ga0182151_1152995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii521Open in IMG/M
3300015338|Ga0182137_1087618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum682Open in IMG/M
3300015339|Ga0182149_1108585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii613Open in IMG/M
3300015339|Ga0182149_1111124Not Available607Open in IMG/M
3300015348|Ga0182115_1116602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii846Open in IMG/M
3300015348|Ga0182115_1305056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii502Open in IMG/M
3300015349|Ga0182185_1169289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SaA2.13655Open in IMG/M
3300015352|Ga0182169_1211021Not Available634Open in IMG/M
3300015352|Ga0182169_1282718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300015352|Ga0182169_1292227All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300015353|Ga0182179_1021784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1521Open in IMG/M
3300015353|Ga0182179_1097860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii874Open in IMG/M
3300015353|Ga0182179_1214591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300015353|Ga0182179_1270412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii550Open in IMG/M
3300015354|Ga0182167_1331942Not Available534Open in IMG/M
3300017414|Ga0182195_1042233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii938Open in IMG/M
3300017414|Ga0182195_1224043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300017432|Ga0182196_1103009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii582Open in IMG/M
3300017432|Ga0182196_1143826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii518Open in IMG/M
3300017439|Ga0182200_1004948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1607Open in IMG/M
3300017445|Ga0182198_1169821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300017446|Ga0182217_1112502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii639Open in IMG/M
3300017692|Ga0182210_1058162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii801Open in IMG/M
3300017693|Ga0182216_1108247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii673Open in IMG/M
3300017693|Ga0182216_1199835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii526Open in IMG/M
3300017693|Ga0182216_1224568Not Available502Open in IMG/M
3300017694|Ga0182211_1110676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii645Open in IMG/M
3300025972|Ga0207668_11882215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300028054|Ga0268306_1033565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300028056|Ga0268330_1029272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SaA2.13660Open in IMG/M
3300028061|Ga0268314_1050573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii516Open in IMG/M
3300028141|Ga0268326_1008533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300028142|Ga0268347_1023782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300028262|Ga0268310_1050914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300032466|Ga0214503_1242297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300032469|Ga0214491_1047949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa1025Open in IMG/M
3300032490|Ga0214495_1071357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa809Open in IMG/M
3300032502|Ga0214490_1109458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii630Open in IMG/M
3300032502|Ga0214490_1148520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300032514|Ga0214502_1145751Not Available909Open in IMG/M
3300032548|Ga0214483_1030234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae904Open in IMG/M
3300032550|Ga0321340_1019012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae961Open in IMG/M
3300032551|Ga0321339_1139427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii537Open in IMG/M
3300032551|Ga0321339_1148919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300032593|Ga0321338_1355710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300032698|Ga0214485_1021694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa1170Open in IMG/M
3300032758|Ga0314746_1001441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum3122Open in IMG/M
3300032761|Ga0314733_1010807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1508Open in IMG/M
3300032781|Ga0314742_1050134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis735Open in IMG/M
3300032792|Ga0314744_1106202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300032821|Ga0314719_1006162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1413Open in IMG/M
3300032826|Ga0314732_122176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300032889|Ga0314751_1075909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SaA2.13682Open in IMG/M
3300032934|Ga0314741_1046643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii998Open in IMG/M
3300033532|Ga0314767_1140912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300033535|Ga0314759_1208994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii621Open in IMG/M
3300033535|Ga0314759_1268308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere79.21%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.93%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere5.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032821Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032826Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070702_10115132613300005615Corn, Switchgrass And Miscanthus RhizosphereNSTSHATNDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQAGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQNDRPLKKRPRS
Ga0068863_10274935113300005841Switchgrass RhizosphereDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQK
Ga0105247_1127018013300009101Switchgrass RhizosphereLVLSEIQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVKNPRLGGQGSSPPENRSADQAGPVRPVSPIGQTGPTGQTGSSNRSDRPGDCPRTFKPKHPEVGTWKTNEVKVQ
Ga0105248_1130577823300009177Switchgrass RhizosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVKNPRLGGQGSSPPENRSADQAQPVRPVSPTGQTGSSNRSDLPGDRPRTFKPKCPEVGTWKTNEMKVQGRIANQKP
Ga0105249_1330582813300009553Switchgrass RhizosphereDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGPTGQTGSSNRSDRSGDRPRTFKPKRPKVGTWKTNEVKVQGRTANQKPTFNQLFNKYTKAVQNNRPLKKRPR
Ga0105133_11665813300009981Switchgrass AssociatedMQIDKAPFPVHTLELNNPKVLIRPEQAERAKGNNVVIGDPRPMDTSDKVLAQEVIKEKTDDGKDNMKITVRNPRLGGQGSSPPENWSADQARLVRPVSPTGQTSSSSRSDRSGDHPQSLKPKRPEVGTWKTNEVKVQGRVANQKPTLNHLLNKYTKAVQK
Ga0105131_12681813300009989Switchgrass AssociatedVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADHARPVRPVSETGQTGPTGQAGPSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRSANQKPTFNQLLNK*
Ga0105126_105418713300009994Switchgrass AssociatedVQSAINEGRLVLSEMHTDKAPFPVHTLELNNPKVLIRPEQDEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGISPPENRSADQTRPVRPVSVTGQTGPTGQTGSSNRSDRFFQPVRPPW*
Ga0105139_109074613300009995Switchgrass AssociatedVHTLELNNPKVLIQPEQAEGAKGKHVVISDPRPMNTSDKILAREVINEKTDDGKSTLKIIVKNPRLGGQGSSPPENRSADQARPVRPVSPTDQTGPTGQTGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRAANQKPTFNQLLNKYTKAVQNDRPLKKSTR*
Ga0105139_109512713300009995Switchgrass AssociatedVIGDPRPMNTSDKILAQEVIKEKTDDGKDTLKIIIRNPRLGGQGSSPPENQSADQARPVRPVSPTGQTGPTGQIGSSSRSDRSGDRPRTFKPKRPEVGTWNTNEVKVQGRTANQKHTFDQLLNKYTNAVQKRSAAKKEIAIATTP*
Ga0105139_110983813300009995Switchgrass AssociatedLNNPKVLIRPEQDEGAKGKNVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPTENRSADQARPVRQVAPTGQTGSSSRSDLSGDRPWTFKPKRPKVGTWKTNEVKVQGRTTNQKPTFNQLLNKYTKAVQNDRPLK
Ga0105139_111303213300009995Switchgrass AssociatedKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPSESRSADQARPVRPVSVTGQTGPTGQAGSSNRSDRLGDRPRTFKPKRPEVGIWKTNEVKVQGRTANQRPHLQPVVEQVYKCRSKRSAIKKETAFTTASRSSSVPKEGIQQ
Ga0134125_1262279323300010371Terrestrial SoilLNNPKVPIRPEQAERAKGKIVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSNRSGDRPQTFKPKRPEVGTWKTNEVKVQG
Ga0157379_1241156213300014968Switchgrass RhizosphereMQIDKAPFSVHTLELNNSKVLIRPDQVEGAKGKNIVIGDPRPMNVSDKILAREVVKEKTDDGKDTLKITIRNPRLGRQGSSPPENRFAAQARPARPVSPTGQTGSIGQTGPSNRSDRSGDRPWT
Ga0182102_102219113300015273Switchgrass PhyllosphereGAKGKHVVIGDPRPMNISDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADHPRPVRPVSPTGQTGQIGSSSRSDRSGDHPRTFKPKRPEVGTWKTNEVKVQGRAANQKPTFN*
Ga0182099_104992413300015278Switchgrass PhyllosphereMQIDKAPFPVHALELNNPKVLIRPEQAEGAKGNHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLRGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSDRSGDRPRTFKPKRPEVGTWKTNKVKV*
Ga0182100_107946813300015280Switchgrass PhyllosphereMQIGKAPFPIHTLELNNPKVLIRPDQAEGAKEKNVVIGDPRPMNANDKILAGEVIKEKTDEGKDTLKITVRNPRLGGQGSSPPESWSVAQARPVRPVSLTGQTGPTGPSNRSDRSSDRPRTFKPKRPEVGTWKTNEVKVQGRAANQKPTFN*
Ga0182105_103867713300015290Switchgrass PhyllosphereVLSEMQIDKAPFPVHTLELNNPKVLIRLEQAEGAKGKNVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLRGQGSSPTENRSAAQSRPVRPAPPTGQTGASDRSDRSGDRPRTFKPKRPKVGT*
Ga0182105_108462013300015290Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADHARPVRPVSETGQTGPTGQTGSSNRSDRPGD
Ga0182105_109305513300015290Switchgrass PhyllosphereATNDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGSSNRSDRPGDRPWTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLN
Ga0182103_102463813300015293Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAERDKGKNVAIGDPRSMDISDKILAREVIKEKTDDGKDTLKVIVRNPRLGGQGNSPPENWSADQVRPVRPVSPTGQTGPTGQTSSSSRSDRSGDRPQTFKPKRPEVGTWKTNEVKVQGRAANQKPTSNQLLNKYTKAVQNDRPLKKDTAIATVPRSSSVSKEGIQQAQG*
Ga0182103_107296413300015293Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQAGSSNRSDRPGDRPRTFKPKHPEVGTWKTNEVKVQGRTANQKPTFNQL
Ga0182104_102486813300015297Switchgrass PhyllosphereMQIDKAHFPVHTLELNNPKVIIRPEQAEGAKGKNVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLGGQESSPSKNRSAAQARPVRPVSPTGKTGPTGPSNRSGNRPRTFKPKRPEVGTWKTNEVKVQGRASNQKPIFN*
Ga0182182_111505813300015311Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRHGGQGSSPSENRSADQARPVRPVSETGQTGPTGQTGSSNRSDCPGDRPRTFKPKRPEVGTWKTNE
Ga0182168_102205313300015312Switchgrass PhyllosphereMQIDKAPFPFYTLELNNSKILIRPDQAEGAKGKNVVIGDPRPMNASDKILAREVVKEKTDDGKDTLKITIRAPRLGGQWSSPPDSRSTAQALPVRPVSPTVPTDPTGSSSRSDRANNRPQTFKPKRPEVGT*
Ga0182164_110306113300015313Switchgrass PhyllosphereKWHNSTSHVTNDCNVFRRHIQSAINEGQLVLSEMQIDKAPFPIHTLGLNNPKVLIRPDQAKGAKGKNAVIGDPKPMNANDKILAREVIKEKTDDGKDTLKITIRNPRLGGQGSSLSENRFAAQARPARPVSPTGQTGSIGQTGPSNRLDRSGNRPWTFKLKCLEVDTWKINGVKVQGRAANQKPTFN
Ga0182164_112681513300015313Switchgrass PhyllosphereINEGRLVLSEMQIDKTPFPVHTLELNNPKVLIRPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADHARPIRPVSPTGQIGSSSRSDRSGDRP*
Ga0182120_103409223300015315Switchgrass PhyllosphereMQVDKTPFLVHTLELNNPKVLLRPKQAEGAQGKNVVIGDPRPMNANDKILAREVASQKTPDGKTTLKIILNAPKPEGQEKSCSQPAVQAQPVRPVPSTGRTGPTGSNDRLDQPREQPRTFKPKRPEVGTWKTNEMKVQGRAANQKPTFNQLLNKYTKAVQNDRPLKKRPR
Ga0182120_106944513300015315Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQESSPPENRSADQARLVRPVSPTGQTGSSSRSDRSGDRPRTFKPKHPEVGTWKTNEVKVQGRAANQKPTFDQLLNKYTKAVQKDRPLKKRPRSPQRQD
Ga0182136_109389913300015317Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQESSPSENRSADQARPVRPVSATCQTGPTGQTGSSNRSDCPRTFKPKCPEVGTWKTNEVKVQGRTANQKPTFNQLLNKY
Ga0182136_111975413300015317Switchgrass PhyllosphereAINEGQLVLSEMQIDKAPFPVHTLELNNPKVLIWPEQAEGAKGKNVIIGDPRPMNTIDKILDREIIKEKTDDGKDTLKIIIKNPRLGGQGSSPPENRSTNQARPVRPVSPTGQTGQTGSCSRSDRSGDRPQTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQNDRPL
Ga0182165_108263813300015320Switchgrass PhyllosphereMQIDKASFPVHTLELNNPKVLIRPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSDCFGDCPRTFKPKRPEVGTWKTNEVKVKGRTANQKPTFN*
Ga0182165_109799313300015320Switchgrass PhyllosphereMLGLNNPKVLIRPDQAKGAKGKNAVIGDPKPMNANDKILAREVIKEKTDDGKDTLKITIINLRLGGQGSSPPENRFAAQARPARPVSPTGQTGSIGQTGPSNRSDRSGDRPWTFKPKRLEVDT
Ga0182114_109842713300015327Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKQVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLGGQGSSPPENRSADQAQPVRPVSPTGQTGPTDSSSRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRSANQKPTFNQLL
Ga0182114_112712513300015327Switchgrass PhyllosphereNPKVLIRPEQAEGAKGKHVDIGDPRPMNTSDKILAREVIKEKTDNGKDTLKIIVRNSRLRGQGSSPPENRSADQARPVRPVSATGQTGPTDQTGSSNRSDRTGDRPRTFKPKHPEVGTWKTNEVKVQGRTANQKPTFN*
Ga0182153_102946113300015328Switchgrass PhyllosphereMRIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKQVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPILEGQGSSPPENRSADQARPARPVSPTGQTGSSNRSDRPGDRPRTFKPKRPEVGTLKTNKVKVQGRATNQKPTFNQLL
Ga0182153_105773813300015328Switchgrass PhyllosphereLVLSEIQIDKALFSIHTLELNNPKVFIRPEQAEGAKGKNVVIGDPRPMNTSDKILARKVIKEKTDDGKDTMKIIIRNPRLGGQGSSPPENRSNAQARLVKPVPPTGSGRSDRSGRSDRCIQLVRPV*
Ga0182153_114388213300015328Switchgrass PhyllosphereYCKWHNSTSHATNDCNVFRQQVQSAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAWEVIKEKTDYGKDTLKIIVRNPRLGGQESSSPENRSTDQAQPVRPASTTGQTGPTGQTDSSSRSDRPGDRPWTFKPKHPKVGTWK
Ga0182135_108052413300015329Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQTGSSNRSDRPGDRPRTFKPKRPE
Ga0182152_114921513300015330Switchgrass PhyllosphereINEVRLVLFEMEIDKAPFSVHMLELSNPKVLIRPEQAEGAKGKNVVIGDPRPINASDKILAREVIKEKTNDGKDTLKINIRNPRPVRLVSPTDQTSQVDSFNWSDRPGDRPRTFKPKRPEVGTWKTDEVKVQGRAASQKPNSNQLLNKYIKAVQKDRPLKKRPRSPPPQD
Ga0182131_108722013300015331Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGPTGQTGSSNRSDRPGDRPRTFKLKRPEVGTWKTNEVKVQGRSAN
Ga0182131_112579813300015331Switchgrass PhyllosphereMQIDKAHFPVHTLELNNPKVLIWPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGPSNRSDRPGDRPRTFKLKRPEVGTWKTNEVKVQ
Ga0182147_114569713300015333Switchgrass PhyllosphereFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNRKVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSQSDRSGDRPRTFKPKRLEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTNAVQN
Ga0182151_111486313300015337Switchgrass PhyllosphereMQIDKALFPVHTLELNNPKVLIWPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTSPTGQTGSSSRSDRSGDRPWTFKPKRPEVGT*
Ga0182151_115299513300015337Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKQVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLGGQGSSPPENRSADQARPVRPVSPTGKTGPTSPSNRSGNRPRTFKPKRPEVGTW
Ga0182137_108761813300015338Switchgrass PhyllosphereLSELQIDEVPFPIRTLELNNPKVLIRPEQAEGAKGKNVVIGDPRLMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLGGQGSSPPENRSAAQARPVRPVSPTGQTGSSSRLDRSGDRPRTFKPKCPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQKDRPLKRDHDRHRTKIVQ
Ga0182149_110858513300015339Switchgrass PhyllosphereMQIDKAPFPIHTLELNNPKVLIRLEQAEGAKGKNVFIGDPRPMNVNDKILVREVVKEKTDDEKDTLKITIRAPRFGRQASSPPDSQSAAQARPVRPVSPTGQTGSSNRSDWSGDGPRSFKPKRPEVGTWKTNEVKVQGRAANQK
Ga0182149_111112413300015339Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADHARPVRPVSETGQTGPTGQAGPSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGR
Ga0182115_111660213300015348Switchgrass PhyllosphereMQIDKAPFPMHTLDLNNSKVLIRLEQAEGAKGKNVVIGDPRSMNANDKILVREVVKEKTSDGEQTLKITITAPRLEGQVGSPSGSQSATQAQLVQSVAATGPTGPTGQTGSSNRSD*
Ga0182115_130505613300015348Switchgrass PhyllosphereMQIDKAPFPVHTLQLNNPKVLIRPEQAEGAKGKNVVIGDLRPMNPSDKILAREVIKEKTDDGKDTLKIIIINPRLRGQGSSPPENRSAAQAQPVRPVSLTGQTGSTGQTGASNRSDRSGDRPRTFKASGSG
Ga0182185_116928923300015349Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIWPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGRDTLKIIVRNPRLGGQGSSPPENRSADQAQPVRPVSPTGPTGQTGSSGRSDCPGDRPRTFKPKHPEVGTWKTNEVKVQGRATN
Ga0182169_121102113300015352Switchgrass PhyllosphereLNNPKVLIRPDQAKGAKGKNTVIGDPKPMNANDKILAREVIKEKTDDGKDTLKITIRNPRLGRQGSSPPENRFAAQARPARPVSPTGQTGSIGQTGPSNRSDRSGDCPWTFKPKRLEVDTWKINGVKV*
Ga0182169_128271813300015352Switchgrass PhyllosphereSEMQIDKAPFPVHMLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKTLAREVVKEKTDDGKDTLKIIIRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTDQAGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRIANQKPTFSQLLNKYTKAVQNDRPLKKRPRS
Ga0182169_129222713300015352Switchgrass PhyllosphereMQVDKAPFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPINTSDKILAREVIKEKTNDGKDTLKIIISNLRLGGQGSSPTENWSAAQARPVGPVSSAGQTSASGRSGRSGDRPRTFKPKRPEVGTWKTNEVKVQGRAANQKPTFNQLLNTYTKAVQKDRPLKKRPRSPPRQD
Ga0182179_102178433300015353Switchgrass PhyllosphereLIRPDQAKGAKGKNAVIGDPKPMNANDKILAREVIKEKTDDGKDTLKITIINPRLGRQGSSPPENRFAAQARPARPVSPTGQTGSIGQTGPSNRSDRSGDCPWTFKPKRLEVDTWKINGVKV*
Ga0182179_109786013300015353Switchgrass PhyllosphereLVLSEIQIDKAPFPVHTLELNNPKILIRPDQAEGAKGKNVVIGDARPMNANDKILAREVVKEKTDDGKDTLKITIRAPRLGGQGSSPPDSRFSAQAQPVRQVSPTGQTCPTGQTGSSNQSDRPSDRPRIFKPKRPEVGT*
Ga0182179_121459113300015353Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARQVRPVSETGQTGPTGQTGSSNRSDHPGDRPRTFKPKHPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQ
Ga0182179_127041213300015353Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSTTGQTGTTGQAGSSNRSDHPGDRPRTFKPKCPEVGTWKTNEVKVQGRTAN
Ga0182167_133194213300015354Switchgrass PhyllosphereEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDNLKIIDRNPRLGGQGSSPPENRFADQAQPVRPVSSTGQTGLAGQTSSSSRSDHPGDRLRTFKPKCPEVGTWKTNEVKVQGRATNQKPTFN*
Ga0182195_104223313300017414Switchgrass PhyllosphereMQIDKAPFPIHTLELNNRKVLMWPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKKKTDDGTNTLKIIVRNSRLGGQGSSPPENRSADQARPVKPVSPTGQTGSSSRSDHSGDHPRTFKPKRLEVGIWKTNEVKVQGRTANQKPTFN
Ga0182195_122404313300017414Switchgrass PhyllosphereLSEMQIDKAPFPVYTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTNDGKDTLKIIVRNPRLGGQGSSPPENRSANQARPVRPMSPTGQTGSSSRSDRSGDHPRTFKPKRPEVGTWKTNKVKVQGRTANHKPTFNQLLNKYTKAVQNDR
Ga0182196_110300913300017432Switchgrass PhyllosphereLNNPKVLIRPEQAERAKGKIVVIGDPRPMDTSDKILAREVIKEKTNDGKDTLKIIVKNPRLAGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSDHSGDHPRTFKPKRLEVGIWKTNEVKVQGRTANQKPTFN
Ga0182196_114382613300017432Switchgrass PhyllosphereSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMNTSDKILAKEVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQIGPIGQTGSPSRLDQSGDHPRTFKPKRPEVGTWKTNEVKVQGRASNRKPTFN
Ga0182200_100494813300017439Switchgrass PhyllosphereAPFSIHMLELKNPKVLIRPEQAEGAKGKNVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKVIVRNPRLGGQGSSLPENRSANQARPVRSVSRTGQTGPTGQTGSSSRSDRSGDRPQTFKPKRLEVGT
Ga0182198_116982113300017445Switchgrass PhyllosphereNDCNVFRRQLQSAINEERLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQAGSSNRSDRPSDRSRTFKPKLPEVGTWKTNEVKVQGRTANQKPTFNQLL
Ga0182217_111250213300017446Switchgrass PhyllosphereTSDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLEFNNPKVLIRPEQAEGAKGKHVVIDDPRPMNTSDKILAREVIKEKTNDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGPTGQTGSSSRSDRSGDRPRTFKPKRPEGVLGRPTR
Ga0182210_105816213300017692Switchgrass PhyllosphereHATNDYNVFRRQVQSAINEGRLVLSEMQIDKAPFSVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMNTSDKILAKEVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSDRSGDRPRTFKPKRPEVGTWKTNEVKVQGRATNQKPTFNQLLNKYTKAVQNDRPLKKRPQSPPR
Ga0182216_110824723300017693Switchgrass PhyllosphereMQIDKAHFPVHTLELNNTKVLIRPEQAEGAKGKQVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIIRNPRLGGQGSSPPENRSADQARPVRPVSQTGPTGPTGSSNRSDRPGDRPRTFKPKRPEVGTWK
Ga0182216_119983513300017693Switchgrass PhyllosphereMQIDKAPFPVHTLELNNPKVLIRPEQTERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPLENRSANQTRLVRPVSLTGQTGPTGQTGSSSRSDRSGDRPRTFKPKRLEVGTWKTNEVKVLGRTANQKPTFN
Ga0182216_122456813300017693Switchgrass PhyllosphereMQIDKAHFPIHTLELNNPNVLIRPKQTEGAKGKNVVISDLRPINANDKILAREVVKKKTNDGKDTMKITIRNPRLGGQGNSPPENRSAAQARPVXSVPLTGQTGPSNRSDRSGDRPQTFKPKRPEVG
Ga0182211_111067623300017694Switchgrass PhyllosphereHMLELNNPKVLIWPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSQSDRSGDCPRTFKPKRLEVGTWKTNEVMVQGRAANQKPTFNQLLNKYTKSVQKDRALKKRPRSPPAKIVQCPQ
Ga0207668_1188221513300025972Switchgrass RhizosphereDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGPTGQTGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLL
Ga0268306_103356513300028054PhyllospherePFPVHMLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQGSSPSENRSADQARPVRPVSETGQTGPTGQTGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQNDRPLKKRPRS
Ga0268330_102927213300028056PhyllosphereLNNPKVLIRPDQAKGAKGKNTVIGDPKPMNANDKILAREVIKEKTDDGKDTLKITIINLRLGGQGSSPPENRFAAQARPARPVSPTGQTGSIGQTGPSNRSDRSGDCPWTFKPKRLEVDTWKINGVKV
Ga0268314_105057313300028061PhyllosphereILSEMQIDKALFPVHTLELNNPKVLIRPEQAERAKRKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPKNQSADQARPVKPVSPTGQTGPTGQTGSSSRSDHSGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPIFNQLLNKYTKAVQND
Ga0268326_100853313300028141PhyllosphereCKWHNSTSHATNDCNVFRRQVQSAINEGRLVLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGPTGQTGSSHRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRATNQKPTFNQLLNKY
Ga0268347_102378213300028142PhyllosphereQVQSAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGQTGSSSRSDRSGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVRNDRPLKKRPRSPPE
Ga0268310_105091413300028262PhyllosphereKALFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSATGQTGPTGQAGSSNRSDRPGDRPRTFKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAFQNDRPLKK
Ga0214503_124229713300032466Switchgrass PhyllosphereLSEMQIDKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMDTSDKILAREVVKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQAQPVRPVSPTGHTGPTGQTGSSNRSDRPGDRPRTFKPKRPEVGTCKTNEVKVQGRATNQKPTFNQLLNKYTKAVQNDRPLKKRPRSPPCQDR
Ga0214491_104794923300032469Switchgrass PhyllosphereLNLVCTWQLVQSAINEGRLVLSEMQIDKAPFLVHTLELNNPKVLIRPEQAEGAKGKHVVIGDLRPMNTSDKIHAREVIKEKTDDEKDTLKIIVRNPRLRGQGSSPPENWSADQARPVRPVSPTGQTGSSSRPDRSGDRPRTFKPKRPEVGTWKTNEVKV
Ga0214495_107135713300032490Switchgrass PhyllosphereVQSAINEGQLVLSEMQTDKAPFPIHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTGQTGPTGQTGSSSRSDRSGDHPRTFKQKCSEVGTWKTNEVKVQGRATN
Ga0214490_110945823300032502Switchgrass PhyllosphereVLIRPEQAERAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQAQPVRPVSPTGQTGPTGSSSRSDRPGDRPRTFKPKRPEVSTWKTNEVKVQGRAINQKSTFNQLLNKYTKAVQ
Ga0214490_114852013300032502Switchgrass PhyllosphereAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKGTLKIIVRNPGLGGQGSSPPENRSADQARPVRPVSPTGPTGQTGSSNRSDRPGDRPRTSKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQNDR
Ga0214502_114575113300032514Switchgrass PhyllosphereMQIDKTPFPVHTLELNNPKVLIRPDQAEGAKGKNIVIVNPRPMNASDKILAREVIKKKTDDGKDTLKITIRNLRLGVQRSSPPENRSAAQARPVRPVSPTGQTGPTGQTGPSNRSDQSHQKPTFNQLEDQRGKGAGKSC
Ga0214483_103023413300032548Switchgrass PhyllosphereTPALFLEPVSTLLEVSSVLALTRQEATLTLARARLKILNLVCTWQLVQSAINEGRLVLSEMQIDKAPFLVHTLELNNPKVLIRPEQAEGAKGKHVVIGDLRPMNTSDKIHAREVIKEKTDDEKDTLKIIVRNSRLRGQGSSPPENWSADQARPVRPVSPTGQTGSSSRPDRSGDRPRTFKPKRPEVGTWKTNEVKV
Ga0321340_101901213300032550Switchgrass PhyllosphereVLIRPEQAEGAKGKNVVIGDPRLMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTGSTGLTGQTGSSSRSDRSGDHPRTFKQKCSKVGTWKTNEVKVQGRAANQKPTFDQLLNKYTKAVQKEWPLKKRL
Ga0321339_113942713300032551Switchgrass PhyllosphereVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTGSTGLTGQTGSSSRSDRSGDHPRTFKQKCSKVGTWKTNEVKVQGRAANQKPTFDQLLNKYTK
Ga0321339_114891913300032551Switchgrass PhyllosphereAPLSAAQMVLEVDRLLKPGGVFILVQSAINEGQLVLSEMQIDKAPFPVHTLELNNAKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGLTGSSSRSDCYGDHPRTFKPKRLEVGTWKTNE
Ga0321338_135571013300032593Switchgrass PhyllosphereVLSEMQIDKAPFPVHTLELNNPKVLIRPEQPEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTEDGKSTLEIIVRNPRLGGQGSSPSENRSADHARPVRPVSETGQTGPTGPSNRSDCPGDRPRTFKPKRPEVGTWKTNEVKVQGRSANQKPTFNQLLNKYTKAVQNDRPLKK
Ga0214485_102169413300032698Switchgrass PhyllosphereTNHCNVFRRQVQSAINEGRLVLSEMQIDKAPFPIHTLELNNRKVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPLENRSADQARPVRPVSLTGQTGPTGQTGSSSRSDRSGDHPRTFKQKCSEVGTWKTNEVKVQGRAANQKPTFDQLLNKYTKAVQKDRPLKKETAIATAPRSSSVSKEGIQQVQR
Ga0314746_100144133300032758Switchgrass PhyllosphereVLNRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTGQTGPTGQTGSSSRSDRSGDHPRTFKQKCSEVGTWKTNEVKVQGRATN
Ga0314733_101080713300032761Switchgrass PhyllosphereKAPFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILTREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTGLTGSSSRSDCYGDHPRTFKPKRLEVGTWKTNEVKV
Ga0314742_105013413300032781Switchgrass PhyllosphereMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMDTNDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSTPPENRSADQARPVRPVSLTGQTGPTGQTGSSSRSDRSGDHPRTFKQKCSEVGT
Ga0314744_110620213300032792Switchgrass PhyllospherePEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPLENRSADQARPVRPVSLTGQTGPTGQTGSSSRSDRSGDHPRTFKQKCSKVGTWKTNEVKVQGRAANQKPTFDQLLNKYTKAVQKEWPLKKRL
Ga0314719_100616223300032821Switchgrass PhyllosphereVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTNDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLIGSTGLTGQTGSSSRSDRSGDHPRTFKQKCSEVGTWKTNEVKVQGRAANQKPTFDQLLNKYTKAVQKEWPLKKRL
Ga0314732_12217613300032826Switchgrass PhyllosphereQVQSAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENWSADQARPVRLVSPTDPTGPTGQTGSSSRSDRSGDRPRTFKPKHLEVGTWKTNEVKV
Ga0314751_107590923300032889Switchgrass PhyllosphereLAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKSTLKIIVRNPRLGGQRSSPSENWSADQARPVRPVSETGLTGQTGSSNRSDRPGDRPRTF
Ga0314741_104664313300032934Switchgrass PhyllosphereVSTLLEVSSVLALTRQEATLTLARARLKILNLVCTWQLVQSAINEGRLVLSEMQIDKAPFLVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSPTSQTGPTGQTALVTIPGLSSQSVRKWVLGIP
Ga0314767_114091213300033532Switchgrass PhyllosphereRQVQSAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENRSADQARPVRPVSLTGSTGLTGQTGSSSRSDRSGDHPRTFKQKCSEVGTWKTNEVKVQGRATN
Ga0314759_120899413300033535Switchgrass PhyllosphereEVSSVLALTRQEATLTLARARLKILNLVCTWQLVQSAINEGRLVLSEMQIDKAPFLVHTLELNNPKVLIRPEQAEGAKGKHVVIGDLRPMNTSDKIHAREVIKEKTDDEKDTLKIIVRNPRLRGQGSSPPENWSADQARPVRPVSPTGQTGSSSRPDRSGDRPRTFKPKRPEVGTWKTNEVKV
Ga0314759_126830813300033535Switchgrass PhyllosphereAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKHVVIGDPRPMNTSDKILAREVIKEKTDDGKGTLKIIVRNPGLGGQGSSPPENRSADQARPVRPVSPTGPTGQTGSSNRSDRPGDRPRTSKPKRPEVGTWKTNEVKVQGRTANQKPTFNQLLNKYTKAVQNDRPLK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.