NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102730

Metagenome Family F102730

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102730
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 43 residues
Representative Sequence METRFVIISYIATFGGIGVLVAAMLRRARSLAQRLPPEDRPWT
Number of Associated Samples 86
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 77.23 %
% of genes near scaffold ends (potentially truncated) 22.77 %
% of genes from short scaffolds (< 2000 bps) 88.12 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (54.455 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.911 % of family members)
Environment Ontology (ENVO) Unclassified
(35.644 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.89%    β-sheet: 0.00%    Coil/Unstructured: 52.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03100CcmE 51.49
PF01578Cytochrom_C_asm 28.71
PF00005ABC_tran 2.97
PF03379CcmB 0.99
PF11305DUF3107 0.99
PF16327CcmF_C 0.99
PF03918CcmH 0.99
PF00578AhpC-TSA 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 51.49
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 0.99
COG3088Cytochrome c-type biogenesis protein CcmH/NrfFPosttranslational modification, protein turnover, chaperones [O] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A54.46 %
All OrganismsrootAll Organisms45.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig180456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300001686|C688J18823_11066951Not Available512Open in IMG/M
3300002568|C688J35102_118615517Not Available577Open in IMG/M
3300002568|C688J35102_120846681Not Available1798Open in IMG/M
3300002568|C688J35102_120947104Not Available2802Open in IMG/M
3300003996|Ga0055467_10071866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter937Open in IMG/M
3300004153|Ga0063455_100130201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter1111Open in IMG/M
3300004156|Ga0062589_100347521Not Available1175Open in IMG/M
3300004156|Ga0062589_101242887Not Available716Open in IMG/M
3300004156|Ga0062589_101462111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis670Open in IMG/M
3300004463|Ga0063356_104003734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis634Open in IMG/M
3300005168|Ga0066809_10185436Not Available556Open in IMG/M
3300005330|Ga0070690_100243165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis1270Open in IMG/M
3300005331|Ga0070670_101281024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis671Open in IMG/M
3300005331|Ga0070670_102244131Not Available503Open in IMG/M
3300005333|Ga0070677_10229923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis910Open in IMG/M
3300005354|Ga0070675_101346933Not Available658Open in IMG/M
3300005355|Ga0070671_101736410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis554Open in IMG/M
3300005365|Ga0070688_100054875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis2498Open in IMG/M
3300005456|Ga0070678_101620691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis608Open in IMG/M
3300005544|Ga0070686_101491601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis570Open in IMG/M
3300005544|Ga0070686_101937534Not Available503Open in IMG/M
3300005578|Ga0068854_100734525Not Available855Open in IMG/M
3300005659|Ga0073900_10127333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter1159Open in IMG/M
3300005874|Ga0075288_1090944Not Available505Open in IMG/M
3300006854|Ga0075425_101173728Not Available873Open in IMG/M
3300009148|Ga0105243_10479944Not Available1173Open in IMG/M
3300009148|Ga0105243_10846024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus905Open in IMG/M
3300009148|Ga0105243_12495473Not Available556Open in IMG/M
3300009176|Ga0105242_12155526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300009177|Ga0105248_10506275Not Available1361Open in IMG/M
3300009177|Ga0105248_12281946Not Available616Open in IMG/M
3300010044|Ga0126310_11713129Not Available522Open in IMG/M
3300010371|Ga0134125_12137353Not Available609Open in IMG/M
3300010375|Ga0105239_12438652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300010400|Ga0134122_10678359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis965Open in IMG/M
3300010401|Ga0134121_13214232Not Available505Open in IMG/M
3300011119|Ga0105246_10232327Not Available1453Open in IMG/M
3300011431|Ga0137438_1113733Not Available827Open in IMG/M
3300012046|Ga0136634_10015789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2549Open in IMG/M
3300012212|Ga0150985_119771499Not Available560Open in IMG/M
3300012212|Ga0150985_120101820Not Available671Open in IMG/M
3300012469|Ga0150984_107118888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1513Open in IMG/M
3300012469|Ga0150984_115070557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAcidi966Open in IMG/M
3300012951|Ga0164300_11075290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300012964|Ga0153916_10057144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3543Open in IMG/M
3300013297|Ga0157378_13150162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium mtb01512Open in IMG/M
3300014498|Ga0182019_10428199Not Available906Open in IMG/M
3300014969|Ga0157376_11156515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300015162|Ga0167653_1054891Not Available700Open in IMG/M
3300015171|Ga0167648_1001309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6645Open in IMG/M
3300015189|Ga0167667_1016155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2133Open in IMG/M
3300015208|Ga0167664_1132518Not Available723Open in IMG/M
3300015371|Ga0132258_10199018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4859Open in IMG/M
3300015371|Ga0132258_13519757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300015372|Ga0132256_101430080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300015372|Ga0132256_103538462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300017695|Ga0180121_10013175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2973Open in IMG/M
3300017944|Ga0187786_10428055Not Available582Open in IMG/M
3300018000|Ga0184604_10269046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300018028|Ga0184608_10098243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300018051|Ga0184620_10106225Not Available871Open in IMG/M
3300018083|Ga0184628_10565532Not Available579Open in IMG/M
3300018429|Ga0190272_10833686Not Available854Open in IMG/M
3300018476|Ga0190274_10960043Not Available926Open in IMG/M
3300018476|Ga0190274_11357780Not Available799Open in IMG/M
3300021082|Ga0210380_10094562Not Available1318Open in IMG/M
3300022756|Ga0222622_11001924Not Available614Open in IMG/M
3300024347|Ga0179591_1083817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis3159Open in IMG/M
3300025271|Ga0207666_1079038Not Available531Open in IMG/M
3300025559|Ga0210087_1061249Not Available750Open in IMG/M
3300025899|Ga0207642_10353755Not Available867Open in IMG/M
3300025901|Ga0207688_10309842Not Available967Open in IMG/M
3300025925|Ga0207650_10899878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis751Open in IMG/M
3300025927|Ga0207687_10803743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter802Open in IMG/M
3300025932|Ga0207690_11748642Not Available519Open in IMG/M
3300025934|Ga0207686_10607298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus861Open in IMG/M
3300025935|Ga0207709_11202066Not Available625Open in IMG/M
3300026035|Ga0207703_11967973Not Available561Open in IMG/M
3300026089|Ga0207648_10001322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter27562Open in IMG/M
3300026142|Ga0207698_10108451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter2321Open in IMG/M
3300027724|Ga0209582_1063445Not Available1295Open in IMG/M
3300027915|Ga0209069_10343832Not Available803Open in IMG/M
3300027991|Ga0247683_1013787Not Available693Open in IMG/M
3300028778|Ga0307288_10058541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1341Open in IMG/M
3300028790|Ga0307283_10220452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter fluminis549Open in IMG/M
3300029984|Ga0311332_11298715Not Available588Open in IMG/M
3300029987|Ga0311334_11345057Not Available602Open in IMG/M
3300030294|Ga0311349_11069769Not Available755Open in IMG/M
3300031170|Ga0307498_10296686Not Available603Open in IMG/M
3300031226|Ga0307497_10494835Not Available602Open in IMG/M
3300031232|Ga0302323_103081817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter531Open in IMG/M
3300031366|Ga0307506_10149712Not Available818Open in IMG/M
3300031726|Ga0302321_100398730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter1498Open in IMG/M
3300032174|Ga0307470_10889863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter698Open in IMG/M
3300033433|Ga0326726_10014636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus6855Open in IMG/M
3300034127|Ga0370489_0100846Not Available842Open in IMG/M
3300034127|Ga0370489_0192580Not Available605Open in IMG/M
3300034268|Ga0372943_0548391Not Available756Open in IMG/M
3300034354|Ga0364943_0451170Not Available502Open in IMG/M
3300034965|Ga0370497_0054577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium mtb01890Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere7.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.95%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.96%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil3.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.97%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.97%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.98%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.98%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.99%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.99%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.99%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.99%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015162Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015189Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)EnvironmentalOpen in IMG/M
3300015208Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027724Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes)EngineeredOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_014093902140918007SoilMETRFVIISYIATFGGIGLLVAAMFRRARVLAKRLPPEDRPWT
C688J18823_1106695113300001686SoilRTPPRGQPVMETGFVILSYVVTFGGIAVLVAAMMRRARGLSARLPPEDQPWT*
C688J35102_11861551723300002568SoilMQTTFVAICWVVTFGGIGVLTTMMMRRARKLAERLPPEDRPWT*
C688J35102_12084668133300002568SoilMQTTFVAICYIATFGGIGLLTAAMMRRARRLADKVPPEDRPWI*
C688J35102_12094710433300002568SoilMETGFVILSYVVTFGGIGILVAAMMRRARGLSARLPPEDQPWT*
Ga0055467_1007186633300003996Natural And Restored WetlandsFVVISYVATFGGIGALVVAMLRRARNLARRLPPEDRPWT*
Ga0063455_10013020133300004153SoilPVMETGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDQPWT*
Ga0062589_10034752123300004156SoilVETSFVIISYVATFGGIGVLVLAMFRRARSLAARLPPEDRPWT*
Ga0062589_10124288713300004156SoilMETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT*
Ga0062589_10146211123300004156SoilMQTTFVTICWVATFGGIGVLTGLMMRRARQLADRVPPEERPWT*
Ga0063356_10400373423300004463Arabidopsis Thaliana RhizosphereMETRFVIASYVATFGGVGVLVLAMLRRARALAERLPPEARPWT*
Ga0066809_1018543613300005168SoilMETSFVALSYIVTFGSIGVLVMVMFRRARSLAQRLPPEDRPWT*
Ga0070690_10024316523300005330Switchgrass RhizosphereMETGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT*
Ga0070670_10128102423300005331Switchgrass RhizosphereMETGFVIVSYVATFGGIGVLVWAMFRRARALATRLPPEDRPWT*
Ga0070670_10224413123300005331Switchgrass RhizosphereRGRRALDGQPGDGALMQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT*
Ga0070677_1022992323300005333Miscanthus RhizosphereMETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEAQPWT*
Ga0070675_10134693323300005354Miscanthus RhizosphereVMETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT*
Ga0070671_10173641013300005355Switchgrass RhizosphereMETGFVIVSYVATFGGIGVLVWAMFRRARTLATRLPPEDRPWT*
Ga0070688_10005487523300005365Switchgrass RhizosphereMKTGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT*
Ga0070678_10162069123300005456Miscanthus RhizosphereMETGFVILSYVVTFGGIGILVAAMMRRARSLSARLPPEDQPWI*
Ga0070686_10149160123300005544Switchgrass RhizosphereMETGFVVLSYVVTFGGIAILVAAMMRRARNLSARLPPEDQPWT*
Ga0070686_10193753423300005544Switchgrass RhizosphereMQTTFVAICYVATFGGIGLLTAAMMRRARQLADKVPPEDRPWT*
Ga0068854_10073452523300005578Corn RhizosphereMQTTFVTICWIATFGGIGVLTGLMMRRARQLADRVPPEERPWT*
Ga0073900_1012733323300005659Activated SludgeMETSFVLISYALTFGGIGVLAFGLMRRARQLAQRTTPEDRPWT*
Ga0075288_109094423300005874Rice Paddy SoilMETRFVIISYIATFGGIGVLVAAMLRRARSLAERLPPEDRPWT*
Ga0075425_10117372813300006854Populus RhizosphereMETGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQP
Ga0105243_1047994423300009148Miscanthus RhizosphereMRDGRCDGARVMETGFVIVSYVATFGGVGVLALAMLRRARTLAERLPPEDRPWI*
Ga0105243_1084602433300009148Miscanthus RhizosphereGDGALMQTTFVTICWVATFGGIGMLTGLMMRRARQLADKVPPEERPWT*
Ga0105243_1249547323300009148Miscanthus RhizosphereMQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT*
Ga0105242_1215552623300009176Miscanthus RhizosphereVETWFVIISYVATFGGVGLLTWAMFRRARSLARRLPPEDRPWT*
Ga0105248_1050627533300009177Switchgrass RhizosphereFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT*
Ga0105248_1228194623300009177Switchgrass RhizosphereMQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEDRPWT*
Ga0126310_1171312923300010044Serpentine SoilVMQTTFVALCYIATFGGLGVLVAGMLRRARSLARRLPPEDRPWT*
Ga0134125_1213735313300010371Terrestrial SoilMQTTFVAICYVATFGGIGVLTAAMMRRARALAKRVPPEDRPWT*
Ga0105239_1243865213300010375Corn RhizosphereLMQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEERPWT*
Ga0134122_1067835933300010400Terrestrial SoilMETGFVIVSYVATFGGIGALVWAMFRRARSLAQRLPPED
Ga0134121_1321423223300010401Terrestrial SoilMETGFVIVSYLATFGGIGALVWAMFRRARSLAQRLPPEDRPWT*
Ga0105246_1023232713300011119Miscanthus RhizosphereETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT*
Ga0137438_111373333300011431SoilMETGFVAVSYIATFGGIAALVLVMLRRARALAQRLPPEDRPWT*
Ga0136634_1001578933300012046Polar Desert SandMESAFVVICYAATFGSVGVLVAAMFRRARSLADRLPDEDRPWT*
Ga0150985_11977149913300012212Avena Fatua RhizosphereLMETGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDKPWT*
Ga0150985_12010182023300012212Avena Fatua RhizosphereMETGFVILSYVVTFGGIAVLVAAMMRRARGLSARLPPEDQPWT*
Ga0150984_10711888823300012469Avena Fatua RhizosphereMQTTFVAICYIATFGGIGLLTALMMRRARQLADKVPPEDRPWI*
Ga0150984_11507055723300012469Avena Fatua RhizosphereMETGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDQPWT*
Ga0164300_1107529013300012951SoilAICYVATFGGIGVLTVAMMRRARSLAKKLPPEDLPWT*
Ga0153916_1005714413300012964Freshwater WetlandsMETRFVIISYIATFGGIGVLVAAMLRRARSLAQRLPPEDRPWT*
Ga0157378_1315016223300013297Miscanthus RhizosphereMETGFVVLSYIATFGGIAILVAAMMRRARNLSARLPPEDQPWT*
Ga0182019_1042819923300014498FenMEMRFVVISYIATFGGIGLLVAVMLRRARALAQRLPPEDRPWT*
Ga0157376_1115651533300014969Miscanthus RhizosphereMQTTFVAICYVATFGGIGLLTAAMMRRARQLADKVPPEERPWT*
Ga0167653_105489133300015162Glacier Forefield SoilIISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT*
Ga0167648_100130933300015171Glacier Forefield SoilMEIRFVIISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT*
Ga0167667_101615533300015189Glacier Forefield SoilMQTTFVVICYVATFGGIGALVAVMLRRGRSLARRLPPEERPWT*
Ga0167664_113251813300015208Glacier Forefield SoilMETGFVVVSYVATFGGIGALVWAMFRRARALAQRLPPEDRPWT*
Ga0132258_1019901833300015371Arabidopsis RhizosphereMETAFVIVSYVATFGGTGILAALMFRRARSLAARLPPEDRPWI*
Ga0132258_1351975723300015371Arabidopsis RhizosphereMETGFVILSYAVTFGGIAILVAAMMRRARSMSARLPPEDQPWT*
Ga0132256_10143008033300015372Arabidopsis RhizosphereFVAICYVATFGGIGLLTAAMMRRARQLADKVPPEERPWT*
Ga0132256_10353846223300015372Arabidopsis RhizosphereVETSFVILSYVVTFGGIAVLVAAMMRRARSMSARLPPEDQPWT*
Ga0180121_1001317533300017695Polar Desert SandMETTFVIVSYVATFGGIGVLILAMLRRARALAQRLPPEDRPWT
Ga0187786_1042805523300017944Tropical PeatlandMETRFVIISYIATFGGIGVLVAAMLRRARSLARRLPPEDRPWT
Ga0184604_1026904623300018000Groundwater SedimentMETGFVIVSYVATFGGVGVLVWAMFRRARTLATRLPPEDRPWT
Ga0184608_1009824333300018028Groundwater SedimentMETGFVIVSYVATFGGIGVLVWAMFRRARSTATRLPPEDRPWT
Ga0184620_1010622533300018051Groundwater SedimentMETGFVIVSYVATFGGIGVLVWAMFRRARALAQRLPPEDRPWT
Ga0184628_1056553223300018083Groundwater SedimentMETGFVAVSYIATFGGIAALVLVMLRRARALAQRLPPEDRPWT
Ga0190272_1083368623300018429SoilMETSFVIVSYVATFGGIGLLVLAMLRRARALAQRLPPEDRPWT
Ga0190274_1096004333300018476SoilVETSFVILSYVATFGGVGLLTWAMLRRARTLAAKLPPEDRPWT
Ga0190274_1135778023300018476SoilVETSFVIISYIATFGGVGLLTWAMFRRARSLAAKLPPEDRPWT
Ga0210380_1009456233300021082Groundwater SedimentMETGFVAVSYIATFGGIAALVLVMLRRARAIAQRLPPEDRPWT
Ga0222622_1100192423300022756Groundwater SedimentMETGFVIVSYVATFGGIGVLVWAMFRRARTLATRLPPEDRPWT
Ga0179591_108381733300024347Vadose Zone SoilMETRFVIISYIATFGGIGVLVAAMFRRARVLAKRLPPEDRPWT
Ga0207666_107903813300025271Corn, Switchgrass And Miscanthus RhizosphereMETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT
Ga0210087_106124923300025559Natural And Restored WetlandsMETRFVIISYIATFGGIGVLVAAMLRRARNLARRLPPEDRPWT
Ga0207642_1035375513300025899Miscanthus RhizosphereMETGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT
Ga0207688_1030984223300025901Corn, Switchgrass And Miscanthus RhizosphereMQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT
Ga0207650_1089987823300025925Switchgrass RhizosphereMETGFVIVSYVATFGGIGVLVWAMFRRARALATRLPPEDRPWT
Ga0207687_1080374323300025927Miscanthus RhizosphereMQTTFVAICYVATFGGIGLLTAAMMRRARQLADTVPPEDRPWT
Ga0207690_1174864223300025932Corn RhizosphereMQTTFVTICWVATFGGIGVLTGLMMRRARQLADRVPPEERPWT
Ga0207686_1060729813300025934Miscanthus RhizosphereVRHRRASPGGEPVMETGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT
Ga0207709_1120206623300025935Miscanthus RhizosphereMETGFVIVSYVATFGGVGVLALAMLRRARTLAERLPPEDRPWI
Ga0207703_1196797323300026035Switchgrass RhizosphereMETGFVILSYVATFGGIAILAAVMMRRARSMSARLPPEDQPWT
Ga0207648_10001322143300026089Miscanthus RhizosphereMETGFVILSYVATFGGIAILVAVMMRRARSMSARRPPEDQPWT
Ga0207698_1010845143300026142Corn RhizosphereMQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEERPWT
Ga0209582_106344523300027724Activated SludgeMETSFVLISYALTFGGIGVLAFGLMRRARQLAQRTTPEDRPWT
Ga0209069_1034383223300027915WatershedsVETWFVIISYVATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT
Ga0247683_101378723300027991SoilMETGFVILSYVVTFGGIAVLVAAMMRRARSMSARLPPEDQPWT
Ga0307288_1005854123300028778SoilMQTTFVAICYAATFGGIGFLTAAMMRRARQLADKLPPEDRSWT
Ga0307283_1022045223300028790SoilMQTTFVAICYVATFGGIGFLTAAMMRRARKLADKLPPEDRSWT
Ga0311332_1129871513300029984FenMEMRFVVISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT
Ga0311334_1134505713300029987FenMEIRFVIISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT
Ga0311349_1106976913300030294FenMEMRFVVISYIATFGGIGVLVAVMLRRARALDQRLPPEDRP
Ga0307498_1029668623300031170SoilVETWFVIISYVATFGGVGLLTWAMFRRARILAAKLPPEDRPWT
Ga0307497_1049483513300031226SoilAISYLATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT
Ga0302323_10308181723300031232FenMETQFVIVSYVATFGGIGVLVVAMLRRARSLAQRLPPEDRPWT
Ga0307506_1014971233300031366SoilWFVIISYVATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT
Ga0302321_10039873033300031726FenRAPRRGGLLMEIRFVVISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT
Ga0307470_1088986323300032174Hardwood Forest SoilMETGFVVLSYVVTFGGIAILVAAMMHRARNLSARLPPEDQPWT
Ga0326726_1001463653300033433Peat SoilMETRFVIISYIATFGGIGVLVAAMLRRARVLAQRLPPEDRPWT
Ga0370489_0100846_650_7813300034127Untreated Peat SoilVETGFVIVSYVATFGGVGLLVLAMFKRARALAAKLPPEDRSWT
Ga0370489_0192580_310_4413300034127Untreated Peat SoilMETGFVILSYVATFGGVAVLTLAMFRRARVLAERLPPEDLPWT
Ga0372943_0548391_86_2173300034268SoilVETSFVIISYVATFGGVGILVLAMFRRARTLAQRLPPEDRPWT
Ga0364943_0451170_312_4433300034354SedimentMETSFVIVSYVATFAGIGVLILAMLRRARALAQRLPPEDRPWT
Ga0370497_0054577_493_6243300034965Untreated Peat SoilMETSFVIICYVATFGGIGVLVVAMLRRARSLAQRLPPEDRPWT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.