Basic Information | |
---|---|
Family ID | F102730 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 43 residues |
Representative Sequence | METRFVIISYIATFGGIGVLVAAMLRRARSLAQRLPPEDRPWT |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 77.23 % |
% of genes near scaffold ends (potentially truncated) | 22.77 % |
% of genes from short scaffolds (< 2000 bps) | 88.12 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.455 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.911 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.644 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF03100 | CcmE | 51.49 |
PF01578 | Cytochrom_C_asm | 28.71 |
PF00005 | ABC_tran | 2.97 |
PF03379 | CcmB | 0.99 |
PF11305 | DUF3107 | 0.99 |
PF16327 | CcmF_C | 0.99 |
PF03918 | CcmH | 0.99 |
PF00578 | AhpC-TSA | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 51.49 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.46 % |
All Organisms | root | All Organisms | 45.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig180456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
3300001686|C688J18823_11066951 | Not Available | 512 | Open in IMG/M |
3300002568|C688J35102_118615517 | Not Available | 577 | Open in IMG/M |
3300002568|C688J35102_120846681 | Not Available | 1798 | Open in IMG/M |
3300002568|C688J35102_120947104 | Not Available | 2802 | Open in IMG/M |
3300003996|Ga0055467_10071866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 937 | Open in IMG/M |
3300004153|Ga0063455_100130201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1111 | Open in IMG/M |
3300004156|Ga0062589_100347521 | Not Available | 1175 | Open in IMG/M |
3300004156|Ga0062589_101242887 | Not Available | 716 | Open in IMG/M |
3300004156|Ga0062589_101462111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 670 | Open in IMG/M |
3300004463|Ga0063356_104003734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 634 | Open in IMG/M |
3300005168|Ga0066809_10185436 | Not Available | 556 | Open in IMG/M |
3300005330|Ga0070690_100243165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 1270 | Open in IMG/M |
3300005331|Ga0070670_101281024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 671 | Open in IMG/M |
3300005331|Ga0070670_102244131 | Not Available | 503 | Open in IMG/M |
3300005333|Ga0070677_10229923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 910 | Open in IMG/M |
3300005354|Ga0070675_101346933 | Not Available | 658 | Open in IMG/M |
3300005355|Ga0070671_101736410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 554 | Open in IMG/M |
3300005365|Ga0070688_100054875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 2498 | Open in IMG/M |
3300005456|Ga0070678_101620691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 608 | Open in IMG/M |
3300005544|Ga0070686_101491601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 570 | Open in IMG/M |
3300005544|Ga0070686_101937534 | Not Available | 503 | Open in IMG/M |
3300005578|Ga0068854_100734525 | Not Available | 855 | Open in IMG/M |
3300005659|Ga0073900_10127333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1159 | Open in IMG/M |
3300005874|Ga0075288_1090944 | Not Available | 505 | Open in IMG/M |
3300006854|Ga0075425_101173728 | Not Available | 873 | Open in IMG/M |
3300009148|Ga0105243_10479944 | Not Available | 1173 | Open in IMG/M |
3300009148|Ga0105243_10846024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus | 905 | Open in IMG/M |
3300009148|Ga0105243_12495473 | Not Available | 556 | Open in IMG/M |
3300009176|Ga0105242_12155526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300009177|Ga0105248_10506275 | Not Available | 1361 | Open in IMG/M |
3300009177|Ga0105248_12281946 | Not Available | 616 | Open in IMG/M |
3300010044|Ga0126310_11713129 | Not Available | 522 | Open in IMG/M |
3300010371|Ga0134125_12137353 | Not Available | 609 | Open in IMG/M |
3300010375|Ga0105239_12438652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300010400|Ga0134122_10678359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 965 | Open in IMG/M |
3300010401|Ga0134121_13214232 | Not Available | 505 | Open in IMG/M |
3300011119|Ga0105246_10232327 | Not Available | 1453 | Open in IMG/M |
3300011431|Ga0137438_1113733 | Not Available | 827 | Open in IMG/M |
3300012046|Ga0136634_10015789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2549 | Open in IMG/M |
3300012212|Ga0150985_119771499 | Not Available | 560 | Open in IMG/M |
3300012212|Ga0150985_120101820 | Not Available | 671 | Open in IMG/M |
3300012469|Ga0150984_107118888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1513 | Open in IMG/M |
3300012469|Ga0150984_115070557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAcidi | 966 | Open in IMG/M |
3300012951|Ga0164300_11075290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300012964|Ga0153916_10057144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3543 | Open in IMG/M |
3300013297|Ga0157378_13150162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium mtb01 | 512 | Open in IMG/M |
3300014498|Ga0182019_10428199 | Not Available | 906 | Open in IMG/M |
3300014969|Ga0157376_11156515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
3300015162|Ga0167653_1054891 | Not Available | 700 | Open in IMG/M |
3300015171|Ga0167648_1001309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6645 | Open in IMG/M |
3300015189|Ga0167667_1016155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2133 | Open in IMG/M |
3300015208|Ga0167664_1132518 | Not Available | 723 | Open in IMG/M |
3300015371|Ga0132258_10199018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4859 | Open in IMG/M |
3300015371|Ga0132258_13519757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300015372|Ga0132256_101430080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300015372|Ga0132256_103538462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300017695|Ga0180121_10013175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2973 | Open in IMG/M |
3300017944|Ga0187786_10428055 | Not Available | 582 | Open in IMG/M |
3300018000|Ga0184604_10269046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
3300018028|Ga0184608_10098243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
3300018051|Ga0184620_10106225 | Not Available | 871 | Open in IMG/M |
3300018083|Ga0184628_10565532 | Not Available | 579 | Open in IMG/M |
3300018429|Ga0190272_10833686 | Not Available | 854 | Open in IMG/M |
3300018476|Ga0190274_10960043 | Not Available | 926 | Open in IMG/M |
3300018476|Ga0190274_11357780 | Not Available | 799 | Open in IMG/M |
3300021082|Ga0210380_10094562 | Not Available | 1318 | Open in IMG/M |
3300022756|Ga0222622_11001924 | Not Available | 614 | Open in IMG/M |
3300024347|Ga0179591_1083817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 3159 | Open in IMG/M |
3300025271|Ga0207666_1079038 | Not Available | 531 | Open in IMG/M |
3300025559|Ga0210087_1061249 | Not Available | 750 | Open in IMG/M |
3300025899|Ga0207642_10353755 | Not Available | 867 | Open in IMG/M |
3300025901|Ga0207688_10309842 | Not Available | 967 | Open in IMG/M |
3300025925|Ga0207650_10899878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 751 | Open in IMG/M |
3300025927|Ga0207687_10803743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 802 | Open in IMG/M |
3300025932|Ga0207690_11748642 | Not Available | 519 | Open in IMG/M |
3300025934|Ga0207686_10607298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus | 861 | Open in IMG/M |
3300025935|Ga0207709_11202066 | Not Available | 625 | Open in IMG/M |
3300026035|Ga0207703_11967973 | Not Available | 561 | Open in IMG/M |
3300026089|Ga0207648_10001322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 27562 | Open in IMG/M |
3300026142|Ga0207698_10108451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 2321 | Open in IMG/M |
3300027724|Ga0209582_1063445 | Not Available | 1295 | Open in IMG/M |
3300027915|Ga0209069_10343832 | Not Available | 803 | Open in IMG/M |
3300027991|Ga0247683_1013787 | Not Available | 693 | Open in IMG/M |
3300028778|Ga0307288_10058541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1341 | Open in IMG/M |
3300028790|Ga0307283_10220452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter fluminis | 549 | Open in IMG/M |
3300029984|Ga0311332_11298715 | Not Available | 588 | Open in IMG/M |
3300029987|Ga0311334_11345057 | Not Available | 602 | Open in IMG/M |
3300030294|Ga0311349_11069769 | Not Available | 755 | Open in IMG/M |
3300031170|Ga0307498_10296686 | Not Available | 603 | Open in IMG/M |
3300031226|Ga0307497_10494835 | Not Available | 602 | Open in IMG/M |
3300031232|Ga0302323_103081817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 531 | Open in IMG/M |
3300031366|Ga0307506_10149712 | Not Available | 818 | Open in IMG/M |
3300031726|Ga0302321_100398730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1498 | Open in IMG/M |
3300032174|Ga0307470_10889863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 698 | Open in IMG/M |
3300033433|Ga0326726_10014636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus | 6855 | Open in IMG/M |
3300034127|Ga0370489_0100846 | Not Available | 842 | Open in IMG/M |
3300034127|Ga0370489_0192580 | Not Available | 605 | Open in IMG/M |
3300034268|Ga0372943_0548391 | Not Available | 756 | Open in IMG/M |
3300034354|Ga0364943_0451170 | Not Available | 502 | Open in IMG/M |
3300034965|Ga0370497_0054577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium mtb01 | 890 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 7.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.95% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.95% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.96% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 3.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.97% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.97% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.98% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.98% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.99% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.99% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.99% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.99% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.99% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027724 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes) | Engineered | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_01409390 | 2140918007 | Soil | METRFVIISYIATFGGIGLLVAAMFRRARVLAKRLPPEDRPWT |
C688J18823_110669511 | 3300001686 | Soil | RTPPRGQPVMETGFVILSYVVTFGGIAVLVAAMMRRARGLSARLPPEDQPWT* |
C688J35102_1186155172 | 3300002568 | Soil | MQTTFVAICWVVTFGGIGVLTTMMMRRARKLAERLPPEDRPWT* |
C688J35102_1208466813 | 3300002568 | Soil | MQTTFVAICYIATFGGIGLLTAAMMRRARRLADKVPPEDRPWI* |
C688J35102_1209471043 | 3300002568 | Soil | METGFVILSYVVTFGGIGILVAAMMRRARGLSARLPPEDQPWT* |
Ga0055467_100718663 | 3300003996 | Natural And Restored Wetlands | FVVISYVATFGGIGALVVAMLRRARNLARRLPPEDRPWT* |
Ga0063455_1001302013 | 3300004153 | Soil | PVMETGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDQPWT* |
Ga0062589_1003475212 | 3300004156 | Soil | VETSFVIISYVATFGGIGVLVLAMFRRARSLAARLPPEDRPWT* |
Ga0062589_1012428871 | 3300004156 | Soil | METGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT* |
Ga0062589_1014621112 | 3300004156 | Soil | MQTTFVTICWVATFGGIGVLTGLMMRRARQLADRVPPEERPWT* |
Ga0063356_1040037342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | METRFVIASYVATFGGVGVLVLAMLRRARALAERLPPEARPWT* |
Ga0066809_101854361 | 3300005168 | Soil | METSFVALSYIVTFGSIGVLVMVMFRRARSLAQRLPPEDRPWT* |
Ga0070690_1002431652 | 3300005330 | Switchgrass Rhizosphere | METGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT* |
Ga0070670_1012810242 | 3300005331 | Switchgrass Rhizosphere | METGFVIVSYVATFGGIGVLVWAMFRRARALATRLPPEDRPWT* |
Ga0070670_1022441312 | 3300005331 | Switchgrass Rhizosphere | RGRRALDGQPGDGALMQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT* |
Ga0070677_102299232 | 3300005333 | Miscanthus Rhizosphere | METGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEAQPWT* |
Ga0070675_1013469332 | 3300005354 | Miscanthus Rhizosphere | VMETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT* |
Ga0070671_1017364101 | 3300005355 | Switchgrass Rhizosphere | METGFVIVSYVATFGGIGVLVWAMFRRARTLATRLPPEDRPWT* |
Ga0070688_1000548752 | 3300005365 | Switchgrass Rhizosphere | MKTGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT* |
Ga0070678_1016206912 | 3300005456 | Miscanthus Rhizosphere | METGFVILSYVVTFGGIGILVAAMMRRARSLSARLPPEDQPWI* |
Ga0070686_1014916012 | 3300005544 | Switchgrass Rhizosphere | METGFVVLSYVVTFGGIAILVAAMMRRARNLSARLPPEDQPWT* |
Ga0070686_1019375342 | 3300005544 | Switchgrass Rhizosphere | MQTTFVAICYVATFGGIGLLTAAMMRRARQLADKVPPEDRPWT* |
Ga0068854_1007345252 | 3300005578 | Corn Rhizosphere | MQTTFVTICWIATFGGIGVLTGLMMRRARQLADRVPPEERPWT* |
Ga0073900_101273332 | 3300005659 | Activated Sludge | METSFVLISYALTFGGIGVLAFGLMRRARQLAQRTTPEDRPWT* |
Ga0075288_10909442 | 3300005874 | Rice Paddy Soil | METRFVIISYIATFGGIGVLVAAMLRRARSLAERLPPEDRPWT* |
Ga0075425_1011737281 | 3300006854 | Populus Rhizosphere | METGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQP |
Ga0105243_104799442 | 3300009148 | Miscanthus Rhizosphere | MRDGRCDGARVMETGFVIVSYVATFGGVGVLALAMLRRARTLAERLPPEDRPWI* |
Ga0105243_108460243 | 3300009148 | Miscanthus Rhizosphere | GDGALMQTTFVTICWVATFGGIGMLTGLMMRRARQLADKVPPEERPWT* |
Ga0105243_124954732 | 3300009148 | Miscanthus Rhizosphere | MQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT* |
Ga0105242_121555262 | 3300009176 | Miscanthus Rhizosphere | VETWFVIISYVATFGGVGLLTWAMFRRARSLARRLPPEDRPWT* |
Ga0105248_105062753 | 3300009177 | Switchgrass Rhizosphere | FVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT* |
Ga0105248_122819462 | 3300009177 | Switchgrass Rhizosphere | MQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEDRPWT* |
Ga0126310_117131292 | 3300010044 | Serpentine Soil | VMQTTFVALCYIATFGGLGVLVAGMLRRARSLARRLPPEDRPWT* |
Ga0134125_121373531 | 3300010371 | Terrestrial Soil | MQTTFVAICYVATFGGIGVLTAAMMRRARALAKRVPPEDRPWT* |
Ga0105239_124386521 | 3300010375 | Corn Rhizosphere | LMQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEERPWT* |
Ga0134122_106783593 | 3300010400 | Terrestrial Soil | METGFVIVSYVATFGGIGALVWAMFRRARSLAQRLPPED |
Ga0134121_132142322 | 3300010401 | Terrestrial Soil | METGFVIVSYLATFGGIGALVWAMFRRARSLAQRLPPEDRPWT* |
Ga0105246_102323271 | 3300011119 | Miscanthus Rhizosphere | ETGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT* |
Ga0137438_11137333 | 3300011431 | Soil | METGFVAVSYIATFGGIAALVLVMLRRARALAQRLPPEDRPWT* |
Ga0136634_100157893 | 3300012046 | Polar Desert Sand | MESAFVVICYAATFGSVGVLVAAMFRRARSLADRLPDEDRPWT* |
Ga0150985_1197714991 | 3300012212 | Avena Fatua Rhizosphere | LMETGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDKPWT* |
Ga0150985_1201018202 | 3300012212 | Avena Fatua Rhizosphere | METGFVILSYVVTFGGIAVLVAAMMRRARGLSARLPPEDQPWT* |
Ga0150984_1071188882 | 3300012469 | Avena Fatua Rhizosphere | MQTTFVAICYIATFGGIGLLTALMMRRARQLADKVPPEDRPWI* |
Ga0150984_1150705572 | 3300012469 | Avena Fatua Rhizosphere | METGFVILSYVVTFGGIAILVAAMMRRARGLSARLPPEDQPWT* |
Ga0164300_110752901 | 3300012951 | Soil | AICYVATFGGIGVLTVAMMRRARSLAKKLPPEDLPWT* |
Ga0153916_100571441 | 3300012964 | Freshwater Wetlands | METRFVIISYIATFGGIGVLVAAMLRRARSLAQRLPPEDRPWT* |
Ga0157378_131501622 | 3300013297 | Miscanthus Rhizosphere | METGFVVLSYIATFGGIAILVAAMMRRARNLSARLPPEDQPWT* |
Ga0182019_104281992 | 3300014498 | Fen | MEMRFVVISYIATFGGIGLLVAVMLRRARALAQRLPPEDRPWT* |
Ga0157376_111565153 | 3300014969 | Miscanthus Rhizosphere | MQTTFVAICYVATFGGIGLLTAAMMRRARQLADKVPPEERPWT* |
Ga0167653_10548913 | 3300015162 | Glacier Forefield Soil | IISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT* |
Ga0167648_10013093 | 3300015171 | Glacier Forefield Soil | MEIRFVIISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT* |
Ga0167667_10161553 | 3300015189 | Glacier Forefield Soil | MQTTFVVICYVATFGGIGALVAVMLRRGRSLARRLPPEERPWT* |
Ga0167664_11325181 | 3300015208 | Glacier Forefield Soil | METGFVVVSYVATFGGIGALVWAMFRRARALAQRLPPEDRPWT* |
Ga0132258_101990183 | 3300015371 | Arabidopsis Rhizosphere | METAFVIVSYVATFGGTGILAALMFRRARSLAARLPPEDRPWI* |
Ga0132258_135197572 | 3300015371 | Arabidopsis Rhizosphere | METGFVILSYAVTFGGIAILVAAMMRRARSMSARLPPEDQPWT* |
Ga0132256_1014300803 | 3300015372 | Arabidopsis Rhizosphere | FVAICYVATFGGIGLLTAAMMRRARQLADKVPPEERPWT* |
Ga0132256_1035384622 | 3300015372 | Arabidopsis Rhizosphere | VETSFVILSYVVTFGGIAVLVAAMMRRARSMSARLPPEDQPWT* |
Ga0180121_100131753 | 3300017695 | Polar Desert Sand | METTFVIVSYVATFGGIGVLILAMLRRARALAQRLPPEDRPWT |
Ga0187786_104280552 | 3300017944 | Tropical Peatland | METRFVIISYIATFGGIGVLVAAMLRRARSLARRLPPEDRPWT |
Ga0184604_102690462 | 3300018000 | Groundwater Sediment | METGFVIVSYVATFGGVGVLVWAMFRRARTLATRLPPEDRPWT |
Ga0184608_100982433 | 3300018028 | Groundwater Sediment | METGFVIVSYVATFGGIGVLVWAMFRRARSTATRLPPEDRPWT |
Ga0184620_101062253 | 3300018051 | Groundwater Sediment | METGFVIVSYVATFGGIGVLVWAMFRRARALAQRLPPEDRPWT |
Ga0184628_105655322 | 3300018083 | Groundwater Sediment | METGFVAVSYIATFGGIAALVLVMLRRARALAQRLPPEDRPWT |
Ga0190272_108336862 | 3300018429 | Soil | METSFVIVSYVATFGGIGLLVLAMLRRARALAQRLPPEDRPWT |
Ga0190274_109600433 | 3300018476 | Soil | VETSFVILSYVATFGGVGLLTWAMLRRARTLAAKLPPEDRPWT |
Ga0190274_113577802 | 3300018476 | Soil | VETSFVIISYIATFGGVGLLTWAMFRRARSLAAKLPPEDRPWT |
Ga0210380_100945623 | 3300021082 | Groundwater Sediment | METGFVAVSYIATFGGIAALVLVMLRRARAIAQRLPPEDRPWT |
Ga0222622_110019242 | 3300022756 | Groundwater Sediment | METGFVIVSYVATFGGIGVLVWAMFRRARTLATRLPPEDRPWT |
Ga0179591_10838173 | 3300024347 | Vadose Zone Soil | METRFVIISYIATFGGIGVLVAAMFRRARVLAKRLPPEDRPWT |
Ga0207666_10790381 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | METGFVVLSYVVTFGGIAILVAAMMRRARSMSARLPPEDQPWT |
Ga0210087_10612492 | 3300025559 | Natural And Restored Wetlands | METRFVIISYIATFGGIGVLVAAMLRRARNLARRLPPEDRPWT |
Ga0207642_103537551 | 3300025899 | Miscanthus Rhizosphere | METGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT |
Ga0207688_103098422 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTTFVTICWVATFGGIGVLTGLMMRRARQLADKVPPEERPWT |
Ga0207650_108998782 | 3300025925 | Switchgrass Rhizosphere | METGFVIVSYVATFGGIGVLVWAMFRRARALATRLPPEDRPWT |
Ga0207687_108037432 | 3300025927 | Miscanthus Rhizosphere | MQTTFVAICYVATFGGIGLLTAAMMRRARQLADTVPPEDRPWT |
Ga0207690_117486422 | 3300025932 | Corn Rhizosphere | MQTTFVTICWVATFGGIGVLTGLMMRRARQLADRVPPEERPWT |
Ga0207686_106072981 | 3300025934 | Miscanthus Rhizosphere | VRHRRASPGGEPVMETGFVILSYVATFGGIAILVAVMMRRARSMSARLPPEDQPWT |
Ga0207709_112020662 | 3300025935 | Miscanthus Rhizosphere | METGFVIVSYVATFGGVGVLALAMLRRARTLAERLPPEDRPWI |
Ga0207703_119679732 | 3300026035 | Switchgrass Rhizosphere | METGFVILSYVATFGGIAILAAVMMRRARSMSARLPPEDQPWT |
Ga0207648_1000132214 | 3300026089 | Miscanthus Rhizosphere | METGFVILSYVATFGGIAILVAVMMRRARSMSARRPPEDQPWT |
Ga0207698_101084514 | 3300026142 | Corn Rhizosphere | MQTTFVAICYVATFGGIGVLTAAMMRRARQLADKVPPEERPWT |
Ga0209582_10634452 | 3300027724 | Activated Sludge | METSFVLISYALTFGGIGVLAFGLMRRARQLAQRTTPEDRPWT |
Ga0209069_103438322 | 3300027915 | Watersheds | VETWFVIISYVATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT |
Ga0247683_10137872 | 3300027991 | Soil | METGFVILSYVVTFGGIAVLVAAMMRRARSMSARLPPEDQPWT |
Ga0307288_100585412 | 3300028778 | Soil | MQTTFVAICYAATFGGIGFLTAAMMRRARQLADKLPPEDRSWT |
Ga0307283_102204522 | 3300028790 | Soil | MQTTFVAICYVATFGGIGFLTAAMMRRARKLADKLPPEDRSWT |
Ga0311332_112987151 | 3300029984 | Fen | MEMRFVVISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT |
Ga0311334_113450571 | 3300029987 | Fen | MEIRFVIISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT |
Ga0311349_110697691 | 3300030294 | Fen | MEMRFVVISYIATFGGIGVLVAVMLRRARALDQRLPPEDRP |
Ga0307498_102966862 | 3300031170 | Soil | VETWFVIISYVATFGGVGLLTWAMFRRARILAAKLPPEDRPWT |
Ga0307497_104948351 | 3300031226 | Soil | AISYLATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT |
Ga0302323_1030818172 | 3300031232 | Fen | METQFVIVSYVATFGGIGVLVVAMLRRARSLAQRLPPEDRPWT |
Ga0307506_101497123 | 3300031366 | Soil | WFVIISYVATFGGVGLLTWAMFRRARTLAAKLPPEDRPWT |
Ga0302321_1003987303 | 3300031726 | Fen | RAPRRGGLLMEIRFVVISYIATFGGIGVLVAVMLRRARALAQRLPPEDRPWT |
Ga0307470_108898632 | 3300032174 | Hardwood Forest Soil | METGFVVLSYVVTFGGIAILVAAMMHRARNLSARLPPEDQPWT |
Ga0326726_100146365 | 3300033433 | Peat Soil | METRFVIISYIATFGGIGVLVAAMLRRARVLAQRLPPEDRPWT |
Ga0370489_0100846_650_781 | 3300034127 | Untreated Peat Soil | VETGFVIVSYVATFGGVGLLVLAMFKRARALAAKLPPEDRSWT |
Ga0370489_0192580_310_441 | 3300034127 | Untreated Peat Soil | METGFVILSYVATFGGVAVLTLAMFRRARVLAERLPPEDLPWT |
Ga0372943_0548391_86_217 | 3300034268 | Soil | VETSFVIISYVATFGGVGILVLAMFRRARTLAQRLPPEDRPWT |
Ga0364943_0451170_312_443 | 3300034354 | Sediment | METSFVIVSYVATFAGIGVLILAMLRRARALAQRLPPEDRPWT |
Ga0370497_0054577_493_624 | 3300034965 | Untreated Peat Soil | METSFVIICYVATFGGIGVLVVAMLRRARSLAQRLPPEDRPWT |
⦗Top⦘ |