NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102888

Metagenome / Metatranscriptome Family F102888

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102888
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 41 residues
Representative Sequence MEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSGLPRELAL
Number of Associated Samples 89
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.20 %
% of genes near scaffold ends (potentially truncated) 94.06 %
% of genes from short scaffolds (< 2000 bps) 94.06 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(34.654 % of family members)
Environment Ontology (ENVO) Unclassified
(38.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.465 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.25%    β-sheet: 0.00%    Coil/Unstructured: 50.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF12680SnoaL_2 5.94
PF05368NmrA 2.97
PF01243Putative_PNPOx 2.97
PF01326PPDK_N 2.97
PF00270DEAD 2.97
PF01565FAD_binding_4 2.97
PF01266DAO 2.97
PF07366SnoaL 2.97
PF08281Sigma70_r4_2 1.98
PF13439Glyco_transf_4 1.98
PF08327AHSA1 1.98
PF12867DinB_2 1.98
PF00891Methyltransf_2 0.99
PF13592HTH_33 0.99
PF09905VF530 0.99
PF00903Glyoxalase 0.99
PF13602ADH_zinc_N_2 0.99
PF00174Oxidored_molyb 0.99
PF02156Glyco_hydro_26 0.99
PF08818DUF1801 0.99
PF08450SGL 0.99
PF13401AAA_22 0.99
PF13377Peripla_BP_3 0.99
PF00356LacI 0.99
PF08031BBE 0.99
PF08020DUF1706 0.99
PF12852Cupin_6 0.99
PF01074Glyco_hydro_38N 0.99
PF13416SBP_bac_8 0.99
PF00296Bac_luciferase 0.99
PF00303Thymidylat_synt 0.99
PF01022HTH_5 0.99
PF01176eIF-1a 0.99
PF00069Pkinase 0.99
PF12697Abhydrolase_6 0.99
PF07690MFS_1 0.99
PF03466LysR_substrate 0.99
PF03029ATP_bind_1 0.99
PF13567DUF4131 0.99
PF04377ATE_C 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.96
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 2.97
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.99
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.99
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.99
COG0383Alpha-mannosidaseCarbohydrate transport and metabolism [G] 0.99
COG1100GTPase SAR1 family domainGeneral function prediction only [R] 0.99
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.99
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.99
COG2229Signal recognition particle receptor subunit beta, a GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.99
COG2935Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.99
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.99
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.99
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.99
COG4124Beta-mannanaseCarbohydrate transport and metabolism [G] 0.99
COG4283Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domainGeneral function prediction only [R] 0.99
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.99
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.99
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.06 %
UnclassifiedrootN/A5.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102IYIGXAll Organisms → cellular organisms → Bacteria505Open in IMG/M
3300000878|AL9A1W_1124647Not Available1374Open in IMG/M
3300001334|A2165W6_1345151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300005186|Ga0066676_10633402All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005435|Ga0070714_101430124All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005435|Ga0070714_102454497All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005536|Ga0070697_100507215All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300005559|Ga0066700_10152928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1564Open in IMG/M
3300005561|Ga0066699_10773660All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005574|Ga0066694_10209231All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300005576|Ga0066708_10195859All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300005598|Ga0066706_10750872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales773Open in IMG/M
3300006050|Ga0075028_100748132All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006797|Ga0066659_10998265All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006806|Ga0079220_10918762All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300006844|Ga0075428_100281340All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300006847|Ga0075431_100406216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1363Open in IMG/M
3300006880|Ga0075429_101674760All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300006914|Ga0075436_100351419All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300007255|Ga0099791_10173942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1011Open in IMG/M
3300007265|Ga0099794_10141225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300009038|Ga0099829_11412686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi575Open in IMG/M
3300009088|Ga0099830_10307509All Organisms → cellular organisms → Bacteria → Terrabacteria group1267Open in IMG/M
3300009088|Ga0099830_10372832All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300009088|Ga0099830_10510832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium981Open in IMG/M
3300009089|Ga0099828_10631462All Organisms → cellular organisms → Bacteria → Terrabacteria group963Open in IMG/M
3300009090|Ga0099827_10506683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria1037Open in IMG/M
3300009090|Ga0099827_11748591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300009094|Ga0111539_12162489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium645Open in IMG/M
3300009147|Ga0114129_10194151All Organisms → cellular organisms → Bacteria → Terrabacteria group2754Open in IMG/M
3300009147|Ga0114129_11021431All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300009148|Ga0105243_10419842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1247Open in IMG/M
3300010046|Ga0126384_11034684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre749Open in IMG/M
3300010303|Ga0134082_10014740All Organisms → cellular organisms → Bacteria2835Open in IMG/M
3300010335|Ga0134063_10411203All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300010359|Ga0126376_12528708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre561Open in IMG/M
3300010362|Ga0126377_11070358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre874Open in IMG/M
3300010376|Ga0126381_102409251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi755Open in IMG/M
3300010398|Ga0126383_12164691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria643Open in IMG/M
3300011269|Ga0137392_10480843All Organisms → cellular organisms → Bacteria → Terrabacteria group1031Open in IMG/M
3300011269|Ga0137392_10614405All Organisms → cellular organisms → Bacteria → Terrabacteria group902Open in IMG/M
3300012003|Ga0120163_1046722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300012096|Ga0137389_10417031All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300012199|Ga0137383_10352639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1078Open in IMG/M
3300012202|Ga0137363_10322954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300012203|Ga0137399_11562513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300012204|Ga0137374_10245225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1506Open in IMG/M
3300012208|Ga0137376_10559886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium990Open in IMG/M
3300012208|Ga0137376_11573489All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012210|Ga0137378_10024208All Organisms → cellular organisms → Bacteria5348Open in IMG/M
3300012211|Ga0137377_11102720All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300012285|Ga0137370_10409698Not Available822Open in IMG/M
3300012351|Ga0137386_10421195All Organisms → cellular organisms → Bacteria → Terrabacteria group961Open in IMG/M
3300012362|Ga0137361_11270131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium660Open in IMG/M
3300012917|Ga0137395_10418776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium960Open in IMG/M
3300012918|Ga0137396_10218248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1404Open in IMG/M
3300012918|Ga0137396_10283587All Organisms → cellular organisms → Bacteria → Terrabacteria group1224Open in IMG/M
3300012923|Ga0137359_10943609All Organisms → cellular organisms → Bacteria → Terrabacteria group742Open in IMG/M
3300012924|Ga0137413_10185327All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300012929|Ga0137404_11711880All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012975|Ga0134110_10068713All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300013296|Ga0157374_12128819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium588Open in IMG/M
3300013296|Ga0157374_12638837All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300013308|Ga0157375_12121852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300013765|Ga0120172_1093100All Organisms → cellular organisms → Bacteria → Terrabacteria group736Open in IMG/M
3300014157|Ga0134078_10073180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. 'Peltigera membranacea cyanobiont' N61234Open in IMG/M
3300015359|Ga0134085_10559405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae528Open in IMG/M
3300015373|Ga0132257_100908616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1104Open in IMG/M
3300018431|Ga0066655_10232433All Organisms → cellular organisms → Bacteria → Terrabacteria group1164Open in IMG/M
3300018465|Ga0190269_11810292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre521Open in IMG/M
3300018468|Ga0066662_10268539All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300020001|Ga0193731_1002816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4518Open in IMG/M
3300021080|Ga0210382_10092648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1250Open in IMG/M
3300021861|Ga0213853_11023585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1149Open in IMG/M
3300022195|Ga0222625_1266376All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300025929|Ga0207664_11780872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre538Open in IMG/M
3300026023|Ga0207677_11188277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300026088|Ga0207641_11552276All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300026297|Ga0209237_1206067All Organisms → cellular organisms → Bacteria → Terrabacteria group625Open in IMG/M
3300026298|Ga0209236_1059868All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300026310|Ga0209239_1010430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4947Open in IMG/M
3300026310|Ga0209239_1062366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis echigonensis1648Open in IMG/M
3300026313|Ga0209761_1075701All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300026542|Ga0209805_1380171All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300027671|Ga0209588_1261946All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027674|Ga0209118_1009314All Organisms → cellular organisms → Bacteria3415Open in IMG/M
3300027681|Ga0208991_1237677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300027748|Ga0209689_1094987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1551Open in IMG/M
3300027875|Ga0209283_10217034All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300027882|Ga0209590_10427733All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300027882|Ga0209590_10497780Not Available787Open in IMG/M
3300027882|Ga0209590_10616560All Organisms → cellular organisms → Bacteria → Terrabacteria group697Open in IMG/M
3300027903|Ga0209488_10118314All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300028711|Ga0307293_10087574All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300028754|Ga0307297_10019887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1883Open in IMG/M
3300028789|Ga0302232_10299011Not Available795Open in IMG/M
3300028803|Ga0307281_10192249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300028884|Ga0307308_10407760All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300030399|Ga0311353_10755063Not Available834Open in IMG/M
3300030520|Ga0311372_11349013Not Available895Open in IMG/M
3300031781|Ga0318547_10476622All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil34.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.95%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.98%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_091078102170459002Grass SoilVKPIVLFSIQFSLSLVAYALVAAWYVVPRLSGRPRETA
AL9A1W_112464723300000878PermafrostMPPIVLFGIQFTFCLAAYALFAWWYGASRLSRLPREVALVPLVWIHV
A2165W6_134515113300001334PermafrostMAPIVLFGIQFTFSLVAYALIAWWYGAPRLAKLPPEVALVPLVWIHA
Ga0066676_1063340213300005186SoilVKPIVLFSIQFSLSLVAYSLIAAWYVVPRLSERPRETALQPPLWVHAFRVAGGA
Ga0070714_10143012423300005435Agricultural SoilMKPILLFGTQFTLSLVAYALLGLWYAVPRLSGLSRQAALQ
Ga0070714_10245449713300005435Agricultural SoilMKPIVLFSLQFTLSLAAYALIAAWYVIPRLSGKPREAALQPLV
Ga0070697_10050721513300005536Corn, Switchgrass And Miscanthus RhizosphereMAPIVLFGIQFTLSLAAYALIAWWYVSPRLARLPREAALVPLVWIHAFRI
Ga0066700_1015292843300005559SoilMEPVVLFGIQFTLSLAAYALIGFWYVVPRLSRLPREMALPPLLWIH
Ga0066699_1077366013300005561SoilMEPMVLFGIQFTLSLLAYLLIAFWYVAPRLSRLPREVALV
Ga0066694_1020923123300005574SoilMAPIVLFGIQFTFCLVAYSLIAWWYGLPRLSALPRAAALVPLVWIHVF
Ga0066708_1019585923300005576SoilMPPIALFGIQFTLALVAYALIAWWYVSPRLAGLRPE
Ga0066706_1075087213300005598SoilMIEPIVLFGIQFTFALIVYALAARSYAVPRLRRIPP
Ga0075028_10074813223300006050WatershedsVPPIVLFGIQFTFCLAAYALIAWWYGAPRLSRLPREVALVPLVWIHAFR
Ga0066659_1099826533300006797SoilMIEPIVLFGIQFTFALIVYALAARWYAVPRLRRVPPAAALV
Ga0079220_1091876223300006806Agricultural SoilMKPIALFSIQFTLSLVAYALIAAWYVIPRLSGKPRNI
Ga0075428_10028134023300006844Populus RhizosphereMAPIVLFSIQFTMSVVAYKWYVQPRLSLLPRDEALAPLLWVR*
Ga0075431_10040621643300006847Populus RhizosphereVIEPIVLFGIQFTLSLVAYALIARWHVWPRLFPLPRAIA
Ga0075429_10167476013300006880Populus RhizosphereMGPVVLFGIQFTLSLAAYLLIAFWYVAPHLSKLPLE
Ga0075436_10035141923300006914Populus RhizosphereMQPIVLFGIQFTFSLVAYALAAWWYLAPRLARLPREL
Ga0099791_1017394233300007255Vadose Zone SoilMEPVVLFGIQFTLALVAYALIGFWYVSPRLSALPREVAL
Ga0099794_1014122513300007265Vadose Zone SoilMEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPREAALV
Ga0099829_1141268623300009038Vadose Zone SoilMDPIVLFGIQFTLSLVAYTLIAFWYVVPRLSGLPR
Ga0099830_1030750913300009088Vadose Zone SoilMPPIVLFGIQFTFSLIAYALIAWWYVAPRLSRLPREAA
Ga0099830_1037283213300009088Vadose Zone SoilMQPIVLFGLQFTFSLVAYALAAWWYLVPRLARLPREIA
Ga0099830_1051083233300009088Vadose Zone SoilMAPIVLFGIQFTFSLAAYALLAWWYLVPRLARLPRELALVPLVWI
Ga0099828_1063146213300009089Vadose Zone SoilMAPIVLFGIQFTFSLAAYALLAWWYLVPRLARLPRELALVPL
Ga0099827_1050668313300009090Vadose Zone SoilMEPTVLFGIQFTLSLVAYTLIAFWYVVPRLSGLPRGEAVMPLL
Ga0099827_1174859113300009090Vadose Zone SoilMEPVVIFGIQFSLSLVAYALIATWYGVPRLSRLPRDLALMPLL
Ga0111539_1216248913300009094Populus RhizosphereMIEPIVLFGIQFTFALIAYALAARWYVVPRLRQLPLLVALVP
Ga0114129_1019415163300009147Populus RhizosphereMEPLVLFGIQFTLSLVIYGLVGFWYVAPRISKLPREA
Ga0114129_1102143113300009147Populus RhizosphereMEPIVLFGIQFTLSLVAYSLVAFWYVAPRLSGLPPEL
Ga0105243_1041984213300009148Miscanthus RhizosphereMEPIILFGLQFTLSLVAYALIAFWYVAPRLSKLPREAAL
Ga0126384_1103468413300010046Tropical Forest SoilVLFSIQFSLSLLAYALIAAWYVVPRLSRWPRETALQPLLWVH
Ga0134082_1001474013300010303Grasslands SoilMPPIALFGIQFTLALVAYALIAWWYVSPRLAGLRPEKALVPLVW
Ga0134063_1041120323300010335Grasslands SoilMEPIVLFSIQFTFFLAAYAVAAWWYVEPRLARLPRELALVP
Ga0126376_1252870813300010359Tropical Forest SoilVKPIVLFSIQFSLSLVAYALIAAWYVVPRLSGRPREAALQPL
Ga0126377_1107035833300010362Tropical Forest SoilVLFSIQFSLSLLAYALIAAWYVVPRLSERPREAALQ
Ga0126381_10240925113300010376Tropical Forest SoilMEPIVLFGLQFTLSLVAYALLAFWYVVPRLSTLPR
Ga0126383_1216469113300010398Tropical Forest SoilMSAISLFGIQFTLSLIGYALAAWWYLAPRLARMPRRDALQPLL
Ga0137392_1048084323300011269Vadose Zone SoilMPPIVLFGIQFTFSLVAYALIAWWYAAPRLFRLPREVALVPLVWIH
Ga0137392_1061440523300011269Vadose Zone SoilMPPIVLFGIQFTFSLVAYALIAWWYGAPRLSRPPR
Ga0120163_104672213300012003PermafrostMAPIVLFGIQFTFSLVAYALIAWWYGSPRLSRLPRELALVPLLWI
Ga0137389_1041703133300012096Vadose Zone SoilMEPIVLFGIQFTFALVAYAVAAWWYLVPRLARLPREAALVPLVW
Ga0137383_1035263923300012199Vadose Zone SoilMEPIALFGIQFTMSLVAYALIAFWYVVPRLSSLPREV
Ga0137363_1032295413300012202Vadose Zone SoilMEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPR
Ga0137399_1156251313300012203Vadose Zone SoilMEPIVLFGIQFTFSLVAYALIAWWYGAPRLARLPREAALVPL
Ga0137374_1024522533300012204Vadose Zone SoilMGPIVLFGIQFTLSLVAYLLIAFWYVAPRLSKLPQEAVLEV
Ga0137376_1055988613300012208Vadose Zone SoilMEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSLLPRELA
Ga0137376_1157348923300012208Vadose Zone SoilMPPIVLFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIHVFRIV
Ga0137378_1002420863300012210Vadose Zone SoilMEPIVLFSIQFTLSLVAYAFIGFWYVAPRLSGLPRDLVASR*
Ga0137377_1110272013300012211Vadose Zone SoilMEPIVLFGIQFTLSLVAYALIGFWYVAPRLSRLSR
Ga0137370_1040969813300012285Vadose Zone SoilMKPFVLFGIQFTFSLVAYGLAAWWYLVPRLARLPREVALVPLVW
Ga0137386_1042119513300012351Vadose Zone SoilMAPIVLFGIQFTFSLVIYAVIGWWYGVPRLSRLPRELALIP
Ga0137361_1127013113300012362Vadose Zone SoilMAPIVLFGIQFTFFLVAYAVAAWWYIAPRLARLPREAALVPLV*
Ga0137395_1041877623300012917Vadose Zone SoilMEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPREAALVPLVWI
Ga0137396_1021824813300012918Vadose Zone SoilMEPIVLFSIQFTLSLLAYLFIAFWYVVPRLSRLPRE
Ga0137396_1028358733300012918Vadose Zone SoilMEPIVLFSIQFTFALVAYAVAAWWYLAPRLARLPRGAAL
Ga0137359_1094360913300012923Vadose Zone SoilMEPIVLFGIQFTFSLVAYALGAWWYLAPRLARLPREVALVPLVWVHV
Ga0137413_1018532723300012924Vadose Zone SoilMAPIVLFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIH
Ga0137404_1171188023300012929Vadose Zone SoilMAPIVVFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIHVFRIV
Ga0134110_1006871313300012975Grasslands SoilMEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRQLALVP
Ga0157374_1212881913300013296Miscanthus RhizosphereMEPIVLFSIQFTLSLVVYLLSGFWYVAPRLLGLSRAAALAPLL
Ga0157374_1263883713300013296Miscanthus RhizosphereMDPFILFGIQFTLSLVGYALVAAWYLEPRLSRMPSAL
Ga0157375_1212185223300013308Miscanthus RhizosphereMTPIVLFSIQFTLSLFSYMLIAAWYVWPRLRNQQRELAL
Ga0120172_109310023300013765PermafrostMEPIVLFGVQFTLSLVAYSLIAFWYVAPRLSGLPRE
Ga0134078_1007318023300014157Grasslands SoilMEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRELALVP
Ga0134085_1055940513300015359Grasslands SoilMEPIVLFGIQFTLSLLAFLLIAFWYVVPRLAGLPR
Ga0132257_10090861613300015373Arabidopsis RhizosphereMIEPIVLFGIQFTFALIAYALAAHWYVVPRLRQLPL
Ga0066655_1023243333300018431Grasslands SoilMEPIVLFGVQFTLSLVAYLLIAFWLVPRLSVLPRELAL
Ga0190269_1181029213300018465SoilVKPMVLFSIQFTLSLVAYALIAAWYVVPRLSGRPREAAPQPLVWVHAF
Ga0066662_1026853923300018468Grasslands SoilMEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRELALVPLLW
Ga0193731_100281683300020001SoilMEPVVIFGIQFTLSLLAYALIAAWYAVPRLSRLPRD
Ga0210382_1009264823300021080Groundwater SedimentMIEPIVLFGIRFTLSLAAYALIALWYVRPRLSRLP
Ga0213853_1102358513300021861WatershedsSVQFTLSLVVYGLSAAWYVAPRLSTLPRELALVPLVNLWAGGRCR
Ga0222625_126637613300022195Groundwater SedimentMKPIVLFGIQFTLSLVAYSLIAFWYVAPHLSALPRELALARYPNQPHSDL
Ga0207664_1178087223300025929Agricultural SoilVTPMVLFSIQFSLSLVAYTLIAAWYVVPRLSERPRETALQPLLWV
Ga0207677_1118827723300026023Miscanthus RhizosphereMIEPIALFGIQFTLSLAVYGLIALWYVTPRLSRLP
Ga0207641_1155227613300026088Switchgrass RhizosphereMEPIVLFGIQFTLSLVAYALIAFWYIRPRLSRLPLEAALVP
Ga0209237_120606723300026297Grasslands SoilMEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSLLPREL
Ga0209236_105986813300026298Grasslands SoilMAPIVLFAIQFTFSLGAYALLAWWYLAPRLAKLPREVALVPLIWIHTFRIAGA
Ga0209239_101043013300026310Grasslands SoilMAPIVLFGIQFTFALVVYALVAWWYVAPRLLGMPREAALVPLVWVHV
Ga0209239_106236633300026310Grasslands SoilMEPIVLFSIQFTFFLAAYAVAAWWYVEPRLARLPRE
Ga0209761_107570143300026313Grasslands SoilMEPIVLFGTQFTLSLAAYAFIAFWDFRVARRLNGA
Ga0209805_138017113300026542SoilMEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSLLLRELALVP
Ga0209588_126194623300027671Vadose Zone SoilMEPIVLFGIQFTFSLVAYALIAWWYGAPRLARLPREAALVPLVWIHAFRIVG
Ga0209118_100931413300027674Forest SoilMEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSGLPRELAL
Ga0208991_123767713300027681Forest SoilMPPIVLFGLQFTFCLVAYALIAWWYGAPRLSKLPRG
Ga0209689_109498713300027748SoilMEPVVLFGIQFTLSLAAYALIGFWYVVPRLSRLPREMALP
Ga0209283_1021703423300027875Vadose Zone SoilMEPIVLFSIQFTLSLLAYLLIAFWYIVPRLSRLPRELALVPL
Ga0209590_1042773343300027882Vadose Zone SoilMEPIVLFGIQFTFFLVAYSLIAWWYGVPRLARLPREAALVPLVWIHA
Ga0209590_1049778013300027882Vadose Zone SoilMKPIALFGAQFTLCLVAYALIAAWYVVPRLAKRAREDAVVPLL
Ga0209590_1061656033300027882Vadose Zone SoilMEPIVLFGIQFTFSLVAYAVAAWWYLAPRLVRLPREVAL
Ga0209488_1011831423300027903Vadose Zone SoilMEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSRLPRDHVGNRGR
Ga0307293_1008757423300028711SoilMEPIVLFGIQFMLSLVAYWLIAFWYVAPRLSGLPPE
Ga0307297_1001988713300028754SoilMIEPIALFGIQFTLSLAAYALIALWYVTPRLSRLPL
Ga0302232_1029901123300028789PalsaLKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPLVWV
Ga0307281_1019224913300028803SoilMIEPIVLFGIQFTLSLAAYALIALWYVRPRLSRLPL
Ga0307308_1040776023300028884SoilMDPIPLFAIQFTLSLVAYALIAFWYVAPRLAGIPRELAL
Ga0311353_1075506323300030399PalsaLKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPLVWVH
Ga0311372_1134901313300030520PalsaLKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPL
Ga0318547_1047662223300031781SoilMKPIVLFSIQFTLSLAAYALIAAWYVIPRLSRKPREAALQTRSGSTPSG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.