NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103479

Metagenome / Metatranscriptome Family F103479

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103479
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 45 residues
Representative Sequence MKTATKVVIALLVGGVALVASQEQPRTYVANCICSICSYFFGE
Number of Associated Samples 74
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.35 %
% of genes near scaffold ends (potentially truncated) 32.67 %
% of genes from short scaffolds (< 2000 bps) 66.34 %
Associated GOLD sequencing projects 60
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere
(13.861 % of family members)
Environment Ontology (ENVO) Unclassified
(57.426 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(78.218 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03965Penicillinase_R 29.70
PF04893Yip1 26.73
PF05569Peptidase_M56 10.89
PF02811PHP 2.97
PF02706Wzz 1.98
PF14520HHH_5 0.99
PF01061ABC2_membrane 0.99
PF12543DUF3738 0.99
PF01391Collagen 0.99
PF01370Epimerase 0.99
PF02357NusG 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 29.70
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 29.70
COG3206Exopolysaccharide export protein/domain GumC/Wzc1Cell wall/membrane/envelope biogenesis [M] 1.98
COG3524Capsule polysaccharide export protein KpsE/RkpRCell wall/membrane/envelope biogenesis [M] 1.98
COG3765LPS O-antigen chain length determinant protein, WzzB/FepE familyCell wall/membrane/envelope biogenesis [M] 1.98
COG3944Capsular polysaccharide biosynthesis protein YveKCell wall/membrane/envelope biogenesis [M] 1.98
COG0250Transcription termination/antitermination protein NusGTranscription [K] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.06 %
UnclassifiedrootN/A5.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101905434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2198Open in IMG/M
3300004114|Ga0062593_100529679All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300004463|Ga0063356_100242971All Organisms → cellular organisms → Bacteria → Acidobacteria2173Open in IMG/M
3300005329|Ga0070683_100001940All Organisms → cellular organisms → Bacteria16203Open in IMG/M
3300005329|Ga0070683_100046634All Organisms → cellular organisms → Bacteria4004Open in IMG/M
3300005329|Ga0070683_100086447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2940Open in IMG/M
3300005329|Ga0070683_100108862All Organisms → cellular organisms → Bacteria → Acidobacteria2614Open in IMG/M
3300005329|Ga0070683_100164042All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300005364|Ga0070673_101004819All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005434|Ga0070709_11155116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales621Open in IMG/M
3300005436|Ga0070713_100080227All Organisms → cellular organisms → Bacteria2782Open in IMG/M
3300005437|Ga0070710_11329616All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005439|Ga0070711_100326147All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300005439|Ga0070711_100409760All Organisms → cellular organisms → Bacteria → Acidobacteria1102Open in IMG/M
3300005459|Ga0068867_100489355All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300005530|Ga0070679_100164166All Organisms → cellular organisms → Bacteria → Acidobacteria2195Open in IMG/M
3300005534|Ga0070735_10002276All Organisms → cellular organisms → Bacteria17563Open in IMG/M
3300005535|Ga0070684_100089367All Organisms → cellular organisms → Bacteria2738Open in IMG/M
3300005535|Ga0070684_100502673All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300005542|Ga0070732_10083164All Organisms → cellular organisms → Bacteria → Acidobacteria1875Open in IMG/M
3300005545|Ga0070695_101231411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia616Open in IMG/M
3300005614|Ga0068856_102286815All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005616|Ga0068852_102514723All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005617|Ga0068859_100013977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8051Open in IMG/M
3300005842|Ga0068858_100912482All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005842|Ga0068858_101186689All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300005843|Ga0068860_100531938All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300006237|Ga0097621_100120627All Organisms → cellular organisms → Bacteria → Acidobacteria2224Open in IMG/M
3300006237|Ga0097621_101695738All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300006358|Ga0068871_100034437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4018Open in IMG/M
3300006358|Ga0068871_100358745All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300006358|Ga0068871_100622865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales983Open in IMG/M
3300009098|Ga0105245_10010585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8024Open in IMG/M
3300009098|Ga0105245_10073092All Organisms → cellular organisms → Bacteria3117Open in IMG/M
3300009098|Ga0105245_10600967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1127Open in IMG/M
3300009098|Ga0105245_11498918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales725Open in IMG/M
3300009098|Ga0105245_11524285Not Available720Open in IMG/M
3300009148|Ga0105243_10507799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1144Open in IMG/M
3300009148|Ga0105243_12166692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales592Open in IMG/M
3300009162|Ga0075423_11863727Not Available649Open in IMG/M
3300009174|Ga0105241_10474529All Organisms → cellular organisms → Bacteria → Acidobacteria1111Open in IMG/M
3300009176|Ga0105242_11117119Not Available803Open in IMG/M
3300009176|Ga0105242_11484217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales708Open in IMG/M
3300009177|Ga0105248_10074699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3810Open in IMG/M
3300009177|Ga0105248_10311289All Organisms → cellular organisms → Bacteria → Acidobacteria1773Open in IMG/M
3300009551|Ga0105238_10824500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales944Open in IMG/M
3300009553|Ga0105249_10076855All Organisms → cellular organisms → Bacteria → Acidobacteria3095Open in IMG/M
3300010359|Ga0126376_11768662All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300010362|Ga0126377_10570494All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300010375|Ga0105239_10031535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5828Open in IMG/M
3300010375|Ga0105239_12610919Not Available589Open in IMG/M
3300010401|Ga0134121_10002962All Organisms → cellular organisms → Bacteria14384Open in IMG/M
3300011119|Ga0105246_10130493All Organisms → cellular organisms → Bacteria → Acidobacteria1876Open in IMG/M
3300011120|Ga0150983_16028494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales553Open in IMG/M
3300012989|Ga0164305_11931989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales537Open in IMG/M
3300013105|Ga0157369_10207802All Organisms → cellular organisms → Bacteria → Acidobacteria2053Open in IMG/M
3300013296|Ga0157374_10077390Not Available3148Open in IMG/M
3300013307|Ga0157372_10009802All Organisms → cellular organisms → Bacteria → Acidobacteria10188Open in IMG/M
3300014325|Ga0163163_10016316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6895Open in IMG/M
3300017930|Ga0187825_10357757All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300017959|Ga0187779_11283113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales518Open in IMG/M
3300020580|Ga0210403_10089047All Organisms → cellular organisms → Bacteria → Acidobacteria2495Open in IMG/M
3300020581|Ga0210399_10143690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1971Open in IMG/M
3300021170|Ga0210400_10877023All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300021432|Ga0210384_10286206All Organisms → cellular organisms → Bacteria → Acidobacteria1484Open in IMG/M
3300021478|Ga0210402_10674337All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300022726|Ga0242654_10268682All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300025898|Ga0207692_10528985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales751Open in IMG/M
3300025906|Ga0207699_10988507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales622Open in IMG/M
3300025911|Ga0207654_10054823All Organisms → cellular organisms → Bacteria → Acidobacteria2305Open in IMG/M
3300025911|Ga0207654_10564766All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300025912|Ga0207707_10160994All Organisms → cellular organisms → Bacteria → Acidobacteria1962Open in IMG/M
3300025913|Ga0207695_10063270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3815Open in IMG/M
3300025914|Ga0207671_10101307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2182Open in IMG/M
3300025914|Ga0207671_10922402All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300025914|Ga0207671_11152876All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300025917|Ga0207660_10463537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1025Open in IMG/M
3300025920|Ga0207649_10236371All Organisms → cellular organisms → Bacteria → Acidobacteria1309Open in IMG/M
3300025921|Ga0207652_10188175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1856Open in IMG/M
3300025927|Ga0207687_10169408All Organisms → cellular organisms → Bacteria → Acidobacteria1683Open in IMG/M
3300025927|Ga0207687_10571032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales951Open in IMG/M
3300025934|Ga0207686_10794853All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300025934|Ga0207686_11396903All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025936|Ga0207670_10150575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1726Open in IMG/M
3300025938|Ga0207704_10338410All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300025942|Ga0207689_10317367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1293Open in IMG/M
3300025944|Ga0207661_10050342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3318Open in IMG/M
3300025944|Ga0207661_10140513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2078Open in IMG/M
3300025960|Ga0207651_10356373All Organisms → cellular organisms → Bacteria → Acidobacteria1233Open in IMG/M
3300026035|Ga0207703_11105003All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300026078|Ga0207702_10196782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1866Open in IMG/M
3300026078|Ga0207702_10292618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1543Open in IMG/M
3300026089|Ga0207648_11266408All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300026555|Ga0179593_1196827All Organisms → cellular organisms → Bacteria2506Open in IMG/M
3300027986|Ga0209168_10017038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4166Open in IMG/M
3300028381|Ga0268264_10319098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1468Open in IMG/M
3300028381|Ga0268264_11503602All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300031057|Ga0170834_112078888Not Available509Open in IMG/M
3300031720|Ga0307469_11663086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales615Open in IMG/M
3300033412|Ga0310810_10049877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5101Open in IMG/M
3300033412|Ga0310810_10203847All Organisms → cellular organisms → Bacteria → Acidobacteria2231Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere13.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere12.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere9.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere4.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.99%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10190543433300000364SoilMVGSNRPVAQPVAVIWCFIMKTASKVAIILLVAGVGLVAAQEKPRQFVENCVCHICSYLFGED*
Ga0062593_10052967923300004114SoilMKTATKVVIALLIGGAALVAAQEGPRTYVADCICGLCSYLFGNS*
Ga0063356_10024297123300004463Arabidopsis Thaliana RhizosphereMKTASKVVIALLMGGVALVAAQEKPRAYVADCICCLCSYLFGE*
Ga0070683_100001940143300005329Corn RhizosphereMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED*
Ga0070683_10004663453300005329Corn RhizosphereMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0070683_10008644733300005329Corn RhizosphereMKTATKVALALLLGGVTLLASQEKPRQYVENCICCLCSYFFGE*
Ga0070683_10010886243300005329Corn RhizosphereMKTVTKVVLVLLVSGVALLASQEGPRTYVENCICCMCSYFFGE*
Ga0070683_10016404223300005329Corn RhizosphereMKTVTKVVLIVLVTGVALLASQEGPRTYVEHCFCGICSYFFGE*
Ga0070673_10100481913300005364Switchgrass RhizosphereMKTATKVIIALLIGGVALVAAQEGPRTYVADCICCLCSYLF
Ga0070709_1115511623300005434Corn, Switchgrass And Miscanthus RhizosphereVMKTATKVALALLLGGVTLLASQEKPRQYVENCICCLCSYFFGE*
Ga0070713_10008022723300005436Corn, Switchgrass And Miscanthus RhizosphereMKTVTKVVLVLLVTGVALLASQEGPRTYVEHCICGICSYFLGE*
Ga0070710_1132961613300005437Corn, Switchgrass And Miscanthus RhizosphereTKAVLVLLVSGVALLASQEGPRTYVENCICCMCSYFFGE*
Ga0070711_10032614713300005439Corn, Switchgrass And Miscanthus RhizosphereMKTVTKAVLVLLVSGVALLASQEGPRTYVENCICCMCSYFFGE*
Ga0070711_10040976023300005439Corn, Switchgrass And Miscanthus RhizosphereMKTATKVMIALLVGGVALVASQEKPRMMVADCICCLCSYLFGQ*
Ga0068867_10048935523300005459Miscanthus RhizosphereMKTVTKTILALLVCGFALVASQEGPRTYVETCICCVCSYLFGE*
Ga0070679_10016416623300005530Corn RhizosphereVGSLWAIAVIWCLIMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED*
Ga0070735_10002276113300005534Surface SoilVILLKQEATVFMKTVTKVVLVFLVTGVALLASQEGPRTYVERCICGICSYFMGE*
Ga0070684_10008936733300005535Corn RhizosphereMKTVTKVVLVLLVSGVALLASQEEPRTYVENCICCMCSYFFGE*
Ga0070684_10050267323300005535Corn RhizosphereCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0070732_1008316433300005542Surface SoilMKTASKVVIALLVGGVALVAAQERPRMYVADCLCCLCSYLFGQ*
Ga0070695_10123141123300005545Corn, Switchgrass And Miscanthus RhizosphereMKVVIALLVGGIALVAAQEGPRTYVVDCICCLCSYFFGQ*
Ga0068856_10228681523300005614Corn RhizosphereMKTVTKAVLVLLVSGVALLASQEGPRTYVENCICCMCSYFF
Ga0068852_10251472313300005616Corn RhizosphereMKTVTKVVLVLLVSGVALLASQEEPRTYVENCICCMCSY
Ga0068859_10001397793300005617Switchgrass RhizosphereMKTATKVIIVLLIGGVALVAAQEGPRTYVADCICCLCSYLFGNS*
Ga0068858_10091248223300005842Switchgrass RhizosphereMKTATKVVIALLVGGVALVASQEQPRTYVANCICSICTYFFGE*
Ga0068858_10118668913300005842Switchgrass RhizosphereMKTATKVVIALLIGGVALVASQEKPRMYIADCVCCLCSYFFGE*
Ga0068860_10053193823300005843Switchgrass RhizosphereMKTVTKVVIALLIGGVALVASQEQPRTYVANCICSICTYFFGE*
Ga0097621_10012062733300006237Miscanthus RhizosphereMKTLTKVVLVLLVTGVALLASQEGPRTYVEHCICDICSYFFGE*
Ga0097621_10169573813300006237Miscanthus RhizosphereASKVAIILLVAGVGLVAAQEKPRHYVENCVCHICSYFFGED*
Ga0068871_10003443743300006358Miscanthus RhizosphereMKTASKVAIILLVAGVGLVAAQEKPRHYVENCVCHICSYFFGED*
Ga0068871_10035874523300006358Miscanthus RhizosphereVILPHQEIAVFMKTLTKVVLVLLVTGVALLASQEGPRTYVEHCICDICSYFFGE*
Ga0068871_10062286523300006358Miscanthus RhizosphereMRTAMKVVIGLLVGGIALVAAQEGPRTYVVDCICCLCSYFFGQ*
Ga0105245_1001058513300009098Miscanthus RhizosphereMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICSICSYFFGED*
Ga0105245_1007309233300009098Miscanthus RhizosphereMKTATKVVIALLIGGVALVAAQEGPRTYVADCICCLCSYLFGNS*
Ga0105245_1060096723300009098Miscanthus RhizosphereMKTASKVAIILLVAGVGLLAAQEKPREYVANCICHICSYFFGED*
Ga0105245_1149891823300009098Miscanthus RhizosphereMKTATKVVIALLIGGVALVASQEQPRTYVANCICSICSYFFGE*
Ga0105245_1152428523300009098Miscanthus RhizosphereMKTATKVVIALLIGGVALVASQEKPRMYIADCVCCLCS
Ga0105243_1050779923300009148Miscanthus RhizosphereMKTATKVVIALLVGGVALVASQEQPRTYVANCICSICSYFFGE*
Ga0105243_1216669223300009148Miscanthus RhizosphereSKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0075423_1186372723300009162Populus RhizosphereSFFVMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED*
Ga0105241_1047452923300009174Corn RhizosphereMKIASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED*
Ga0105242_1111711913300009176Miscanthus RhizosphereMKTATKVVIALLIGGVALVASQEKPRMYIADCVCCLCSY
Ga0105242_1148421713300009176Miscanthus RhizosphereAVIWCLVMKTASKVAIILLVAGVGLMAAQEKPREYVANCICHICSYFFGED*
Ga0105248_1007469913300009177Switchgrass RhizosphereIWCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0105248_1031128943300009177Switchgrass RhizosphereMKTASKVAIILLVAGVGLVAAQEKPREYVANCICH
Ga0105238_1082450023300009551Corn RhizosphereVILLSQETGIMKTMTKTILALLICGVALVASQEGPRTYVENCVCCLCSYFFGE*
Ga0105249_1007685513300009553Switchgrass RhizosphereKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0126376_1176866223300010359Tropical Forest SoilMKTATKVLIALLVGGVALVAAQEKPRMMVAECICCLCSYLFGQ*
Ga0126377_1057049433300010362Tropical Forest SoilMSIFVKVTAILGVSAVALLASQPEARAYVENCICCICSHLFGS*
Ga0105239_1003153513300010375Corn RhizosphereKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0105239_1261091923300010375Corn RhizosphereMKTITKAALVLLLCGGALLASQENARVYVGHCICDICSYFFGD
Ga0134121_1000296283300010401Terrestrial SoilMRTATKVVIALLVGGIALVAAQEGPRTYVVDCICCLCSYFFGQ*
Ga0105246_1013049323300011119Miscanthus RhizosphereMKTATKVVIALLIGGVALVASQEQPRTYVANCICSICTYFFGE*
Ga0150983_1602849423300011120Forest SoilKTASKVVIALLIGGVALVASQEKPRMYVADCICCLCSYFCGQ*
Ga0164305_1193198923300012989SoilASHRQIVVISCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED*
Ga0157369_1020780223300013105Corn RhizosphereMKTVTKVVLLLLVSGVALLASQEEPRTYVENCICCMCSYFFGE*
Ga0157374_1007739033300013296Miscanthus RhizosphereMKTITKAALVLVLCGGALLASQENARVYVGHCICDICSYFFGE*
Ga0157372_1000980223300013307Corn RhizosphereMKTASKAAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED*
Ga0163163_1001631663300014325Switchgrass RhizosphereMKTASKVLIVLLVAGVGLVAAQEKPRQYVENCICSICSYLFGD*
Ga0187825_1035775723300017930Freshwater SedimentMKTATKVVMALLVAGVALVAAQEGPRTYVAGCICSLCSYLFGQ
Ga0187779_1128311313300017959Tropical PeatlandNREVFFVKTVTKVVLVLLVTGVALLASQEGPRTYVEHCICGICSYFFE
Ga0210403_1008904713300020580SoilMKTATKVVIALLLGGVALVAAQEKPRTYVENCICCLCSYFFGE
Ga0210399_1014369023300020581SoilMKTATKVVIALLVAGVALVAAQEKPRMYVEDCICCLCSYFFGQ
Ga0210400_1087702313300021170SoilLVLLVSGVALLASQEGPRTYVEQCFCSMCSYFFGE
Ga0210384_1028620633300021432SoilMKTASKVVIALLVAGVALVAAQEGPRTYVENCICCLCSYLFGQ
Ga0210402_1067433723300021478SoilMKTVTKVVLVLLVTGVALLASQEGPRTYVEHCFCGICSYFFGE
Ga0242654_1026868213300022726SoilATKVVLALLVGGVALVAAQEGPRTYVANCICCMCSYLFGQ
Ga0207692_1052898523300025898Corn, Switchgrass And Miscanthus RhizosphereMKTVTKVVLVLLVTGVALLASQEGPRTYVEHCICGICSYFIGE
Ga0207699_1098850713300025906Corn, Switchgrass And Miscanthus RhizosphereVMKTATKVALALLLGGVTLLASQEKPRQYVENCICCLCSYFFGE
Ga0207654_1005482313300025911Corn RhizosphereMIWCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHIC
Ga0207654_1056476613300025911Corn RhizosphereMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHI
Ga0207707_1016099433300025912Corn RhizosphereVGSLWAIAVIWCLIMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED
Ga0207695_1006327043300025913Corn RhizosphereMKTATKVALALLLGGVTLLASQEKPRQYVENCICCLCSYFFGE
Ga0207671_1010130733300025914Corn RhizosphereMKTVTKVVLVLLVSGVALLASQEEPRTYVENCICCMCSYFFGE
Ga0207671_1092240223300025914Corn RhizosphereMKTLTKVVLVLLVTGVALLASQEGPRTYVEHCICDICSYFFGE
Ga0207671_1115287613300025914Corn RhizosphereMKTVTKVVLIVLVTGVALLASQEGPRTYVEHCFCGICSY
Ga0207660_1046353733300025917Corn RhizosphereMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGED
Ga0207649_1023637123300025920Corn RhizosphereVGSLWAIAVIWCLIMKTASKVAIILLVAGVGLVAAQEKPREYVSNCICHICSYFFGED
Ga0207652_1018817523300025921Corn RhizosphereVGSLWAIAVIWCLIMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED
Ga0207687_1016940813300025927Miscanthus RhizosphereMKTATKVVIALLIGGVALVAAQEGPRTYVADCICCLCSYLFGNS
Ga0207687_1057103223300025927Miscanthus RhizosphereMKTATKVVIALLIGGVALVASQEQPRTYVANCICSICSYFFGE
Ga0207686_1079485323300025934Miscanthus RhizosphereMKTATKVIIVLLIGGVALVAAQEGPRTYVADCICCLCSYLFGNS
Ga0207686_1139690323300025934Miscanthus RhizosphereMKTVTKAVLVLLVSGVALLASQEGPRTYVENCICCMCSYF
Ga0207670_1015057513300025936Switchgrass RhizosphereMKTATKVVIALLIGGVALVASQEQPRTYVANCICSICTYFFG
Ga0207704_1033841023300025938Miscanthus RhizosphereMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED
Ga0207689_1031736723300025942Miscanthus RhizosphereMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICSICSYFFGED
Ga0207661_1005034243300025944Corn RhizospherePIAMIWCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED
Ga0207661_1014051333300025944Corn RhizosphereMKTVTKVVLVLLVSGVALLASQEGPRTYVENCICCMCSYFFGE
Ga0207651_1035637333300025960Switchgrass RhizosphereVFHQVMRSGRFPASHRQIVVISCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED
Ga0207703_1110500323300026035Switchgrass RhizosphereMKTATKVVIALLVGGVALVASQEQPRTYVANCICSICTYFFGE
Ga0207702_1019678233300026078Corn RhizosphereMCGVGSLWAIAVIWCLIMKTASKVAIILLVAGVGLVAAQEKPRQYVENCICHICSYFFGE
Ga0207702_1029261813300026078Corn RhizosphereVVAVIWCLVMKTASKVAIILLVAGVGLVAAQEKPREYVANCICHICSYFFGED
Ga0207648_1126640813300026089Miscanthus RhizosphereMKTVTKTILALLVCGFALVASQEGPRTYVETCICCVCSYLFG
Ga0179593_119682723300026555Vadose Zone SoilMKNVTKAVLVLLVCSVALLASQEKPRMYVENCICSMCSYLFGE
Ga0209168_1001703833300027986Surface SoilMKTVTKVVLVFLVTGVALLASQEGPRTYVERCICGICSYFMGE
Ga0268264_1031909823300028381Switchgrass RhizosphereMKTVTKVVIALLIGGVALVASQEQPRTYVANCICSICTYFFGE
Ga0268264_1150360223300028381Switchgrass RhizosphereMKTATKVVIALLIGGVALVASQEKPRMYIADCVCCLCSYFFGE
Ga0170834_11207888823300031057Forest SoilMKTATKVVIALLLGGVALVAAQEKPRMYAENCICSLCSYLFGE
Ga0307469_1166308623300031720Hardwood Forest SoilMKTATKVMIALLVGGVALVAAQEGPRNYVADCVCGVANCVCSLCSYLFGQ
Ga0310810_1004987753300033412SoilMKTATKVVIALLIGGAALVAAQEGPRTYVADCICGLCSYLFGNS
Ga0310810_1020384723300033412SoilMKTATKVVIALLLGGVALLASQEKPRMYVEDCICCLCSYLFGQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.