Basic Information | |
---|---|
Family ID | F103609 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 41 residues |
Representative Sequence | TNNDGLWILRYNRPALLEPAKKKPPCDSNAEIMAMPPDCD |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.01 % |
% of genes from short scaffolds (< 2000 bps) | 93.07 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.455 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.842 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.614 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (70.297 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF14534 | DUF4440 | 20.79 |
PF12849 | PBP_like_2 | 3.96 |
PF10647 | Gmad1 | 0.99 |
PF00501 | AMP-binding | 0.99 |
PF02517 | Rce1-like | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.46 % |
Unclassified | root | N/A | 45.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001131|JGI12631J13338_1017324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101790257 | Not Available | 515 | Open in IMG/M |
3300003368|JGI26340J50214_10047419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
3300004080|Ga0062385_10643911 | Not Available | 676 | Open in IMG/M |
3300004119|Ga0058887_1270671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
3300004152|Ga0062386_100322703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
3300004152|Ga0062386_101550638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300004464|Ga0068983_141149 | Not Available | 532 | Open in IMG/M |
3300004476|Ga0068966_1391105 | Not Available | 528 | Open in IMG/M |
3300004598|Ga0068975_1149770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300004613|Ga0068937_1245267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300004966|Ga0072328_1160053 | Not Available | 556 | Open in IMG/M |
3300004972|Ga0072325_1225170 | Not Available | 518 | Open in IMG/M |
3300005591|Ga0070761_10353406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300005610|Ga0070763_10263870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
3300005610|Ga0070763_10511897 | Not Available | 688 | Open in IMG/M |
3300005712|Ga0070764_10875187 | Not Available | 562 | Open in IMG/M |
3300005921|Ga0070766_10595419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300006176|Ga0070765_100570945 | Not Available | 1066 | Open in IMG/M |
3300009523|Ga0116221_1072608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1552 | Open in IMG/M |
3300009524|Ga0116225_1207975 | Not Available | 883 | Open in IMG/M |
3300009552|Ga0116138_1230736 | Not Available | 512 | Open in IMG/M |
3300009631|Ga0116115_1080221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300009636|Ga0116112_1025335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1945 | Open in IMG/M |
3300009665|Ga0116135_1103061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300009700|Ga0116217_10951917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300009759|Ga0116101_1058849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
3300011052|Ga0138585_171764 | Not Available | 544 | Open in IMG/M |
3300011064|Ga0138525_1087922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300011078|Ga0138565_1089399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300011086|Ga0138564_1149207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300011110|Ga0138578_1203168 | Not Available | 651 | Open in IMG/M |
3300011120|Ga0150983_10819682 | Not Available | 556 | Open in IMG/M |
3300011120|Ga0150983_15946903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300011120|Ga0150983_16372622 | Not Available | 551 | Open in IMG/M |
3300014161|Ga0181529_10738034 | Not Available | 506 | Open in IMG/M |
3300014168|Ga0181534_10875655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300017823|Ga0187818_10043473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1929 | Open in IMG/M |
3300017933|Ga0187801_10307407 | Not Available | 646 | Open in IMG/M |
3300017942|Ga0187808_10267119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300017955|Ga0187817_10997843 | Not Available | 536 | Open in IMG/M |
3300017955|Ga0187817_11108594 | Not Available | 508 | Open in IMG/M |
3300017966|Ga0187776_10484711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300017972|Ga0187781_10423527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
3300017996|Ga0187891_1078167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300018001|Ga0187815_10081209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
3300018026|Ga0187857_10148792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
3300018040|Ga0187862_10648508 | Not Available | 621 | Open in IMG/M |
3300018042|Ga0187871_10268847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
3300018057|Ga0187858_10140795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1613 | Open in IMG/M |
3300018085|Ga0187772_10010251 | All Organisms → cellular organisms → Bacteria | 5064 | Open in IMG/M |
3300018085|Ga0187772_10393561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
3300018085|Ga0187772_10759538 | Not Available | 698 | Open in IMG/M |
3300018086|Ga0187769_10422547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1003 | Open in IMG/M |
3300019166|Ga0184595_107547 | Not Available | 535 | Open in IMG/M |
3300019166|Ga0184595_117269 | Not Available | 531 | Open in IMG/M |
3300019183|Ga0184601_123335 | Not Available | 533 | Open in IMG/M |
3300019258|Ga0181504_1137861 | Not Available | 606 | Open in IMG/M |
3300019275|Ga0187798_1332727 | Not Available | 507 | Open in IMG/M |
3300019278|Ga0187800_1427501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300019284|Ga0187797_1830999 | Not Available | 518 | Open in IMG/M |
3300020580|Ga0210403_10168400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1795 | Open in IMG/M |
3300020582|Ga0210395_11413315 | Not Available | 507 | Open in IMG/M |
3300021180|Ga0210396_10959016 | Not Available | 726 | Open in IMG/M |
3300021402|Ga0210385_11500366 | Not Available | 515 | Open in IMG/M |
3300021405|Ga0210387_11089730 | Not Available | 697 | Open in IMG/M |
3300021475|Ga0210392_10219912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
3300021479|Ga0210410_10627150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
3300021559|Ga0210409_11408391 | Not Available | 573 | Open in IMG/M |
3300022504|Ga0242642_1055793 | Not Available | 624 | Open in IMG/M |
3300022509|Ga0242649_1078092 | Not Available | 506 | Open in IMG/M |
3300022528|Ga0242669_1138084 | Not Available | 502 | Open in IMG/M |
3300022533|Ga0242662_10332469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300022711|Ga0242674_1038322 | Not Available | 625 | Open in IMG/M |
3300022716|Ga0242673_1136893 | Not Available | 504 | Open in IMG/M |
3300022717|Ga0242661_1151514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300023660|Ga0247550_105234 | Not Available | 507 | Open in IMG/M |
3300025459|Ga0208689_1023407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1618 | Open in IMG/M |
3300027660|Ga0209736_1211674 | Not Available | 501 | Open in IMG/M |
3300027854|Ga0209517_10416767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300027855|Ga0209693_10050441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2047 | Open in IMG/M |
3300027889|Ga0209380_10046343 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
3300027889|Ga0209380_10285742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300027895|Ga0209624_10607332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300027986|Ga0209168_10194857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
3300028863|Ga0302218_10144309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300029939|Ga0311328_10112553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2246 | Open in IMG/M |
3300029943|Ga0311340_11534788 | Not Available | 520 | Open in IMG/M |
3300030007|Ga0311338_10735184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
3300030058|Ga0302179_10514319 | Not Available | 525 | Open in IMG/M |
3300030490|Ga0302184_10159563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
3300030743|Ga0265461_13627585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300030815|Ga0265746_1037779 | Not Available | 641 | Open in IMG/M |
3300031128|Ga0170823_15082435 | Not Available | 556 | Open in IMG/M |
3300031708|Ga0310686_104455438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6882 | Open in IMG/M |
3300031708|Ga0310686_114993989 | Not Available | 643 | Open in IMG/M |
3300031715|Ga0307476_10032790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3462 | Open in IMG/M |
3300031890|Ga0306925_12002960 | Not Available | 546 | Open in IMG/M |
3300032119|Ga0316051_1028260 | Not Available | 543 | Open in IMG/M |
3300033158|Ga0335077_10149155 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
3300033405|Ga0326727_10702629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.84% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.94% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.94% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.95% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.96% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.97% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.99% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004464 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 81 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004613 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004966 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300011052 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019166 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12631J13338_10173243 | 3300001131 | Forest Soil | FLTNNEGLWVLRYVRPALLEPAKQKKPCGSEAEIQAMPPDCD* |
JGIcombinedJ26739_1017902573 | 3300002245 | Forest Soil | LTNNEGLWVLRYSRPALLEPAKKKRPCDSETEIMAMPPDCD* |
JGI26340J50214_100474193 | 3300003368 | Bog Forest Soil | NNDGLWILRYQHPSRFEPAKKKPPCDSEAEIQAMPPDCQ* |
Ga0062385_106439112 | 3300004080 | Bog Forest Soil | DGYHGLIYLTNNEGLWILRYNRSATLEPSKQKPPCDSASAIMAMPPDCD* |
Ga0058887_12706713 | 3300004119 | Forest Soil | YLTNNEGLWVLRYSRPALLEPAKKKRPCDSETEIMAMPPDCD* |
Ga0062386_1003227031 | 3300004152 | Bog Forest Soil | LIYLTNNEGLWILRYNRPAPLEPARKKPPCDSESAIMAMPPDCD* |
Ga0062386_1015506382 | 3300004152 | Bog Forest Soil | IYLTNNEGLWILRYTRPALLEPAKKKRPCDSESEIEAMPPECD* |
Ga0068983_1411491 | 3300004464 | Peatlands Soil | NNDGLYVLRYNHPSRFEPAKTKPPCTSESEIQAMPPDCQ* |
Ga0068966_13911052 | 3300004476 | Peatlands Soil | TNNEGLWILRYSHPSLLEPAKKKPPCDSNSEIMSMPPDCD* |
Ga0068975_11497702 | 3300004598 | Peatlands Soil | GLIYLTNNEGLWILRYTRPPLLEPAKKKRPCDSESEIEAMPPECD* |
Ga0068937_12452672 | 3300004613 | Peatlands Soil | IYLTNNEGLWILRYNRPALLEPAKKKRPCDSNSDLMAMPPDCD* |
Ga0072328_11600533 | 3300004966 | Peatlands Soil | HGLIYLTNNDGLYVLRYNHPSRFEPAKTKPPCTSESEIQAMPPDCQ* |
Ga0072325_12251702 | 3300004972 | Peatlands Soil | NNEGLWILRYNRPALLEPAKKKRPCDSESAIMSMPPECD* |
Ga0070761_103534061 | 3300005591 | Soil | TNNDGLWILRYNRPALLEPAKKKPPCDSNAEIMAMPPDCD* |
Ga0070763_102638701 | 3300005610 | Soil | IYLTNNEGLWILRYNRPPLLEPAKKKPPCDSESQIMAMPPDCD* |
Ga0070763_105118971 | 3300005610 | Soil | LLPDSHRGLIFLTNNEGLWVLRYIRPALLEPAKQKKPCSSEADIQAMPPDCD* |
Ga0070764_108751872 | 3300005712 | Soil | IFLTNNDGLWILRYNRPALLEPAKKKPPCDSNSEIMAMPPDCD* |
Ga0070766_105954191 | 3300005921 | Soil | GLIYLTNNEGLWVLRYSRPALLEPAKKKRPCDSETEIMAMPPDCD* |
Ga0070765_1005709453 | 3300006176 | Soil | EGLWILRYNRPSLLEPAKKKPPCDSNAEIMSMPPDCD* |
Ga0116221_10726085 | 3300009523 | Peatlands Soil | WILRYNRPSMLEPVKKKPPCDSNSAIMAMPPDCD* |
Ga0116225_12079751 | 3300009524 | Peatlands Soil | VTKNGGLWILRYSPPSLREPRKKKPPCDSNYEIMSMPPDCD* |
Ga0116138_12307362 | 3300009552 | Peatland | LIYLTNNDGLYILRYEHPSRFEPAKKKPPCDSEAEIQAMPPDCQ* |
Ga0116115_10802211 | 3300009631 | Peatland | GLIYLTNNDGLWILRYDHPSRFEPAKKKPPCDSESEIMAMPPDCD* |
Ga0116112_10253351 | 3300009636 | Peatland | GLWILRYNRPLRLEPAKKKPPCDSESAIMAMPPDCD* |
Ga0116135_11030611 | 3300009665 | Peatland | LPDSHRGLIFLTNNEGLWVLRYIRPALLEPAKQKKPCGSEADIQAMPPDCD* |
Ga0116217_109519171 | 3300009700 | Peatlands Soil | LIYLANNEGLWILRYSRAALLEPAKKKRPCDSETEIMAMPPDCD* |
Ga0116101_10588493 | 3300009759 | Peatland | EGLWVLRYNRPALLEPAKQKKPCSSESDIQAMPPDCD* |
Ga0138585_1717642 | 3300011052 | Peatlands Soil | LTNNEGLWILRYNRPSMLEPAKKKPPCDSNSAIMAMPPDCD* |
Ga0138525_10879222 | 3300011064 | Peatlands Soil | LIYLTNNEGLWILRYTRPPLLEPAKKKRPCDSESEIEAMPPECD* |
Ga0138565_10893992 | 3300011078 | Peatlands Soil | HGLIYLTNNEGLWILRYTRPPLLEPAKKKRPCDSESEIEAMPPECD* |
Ga0138564_11492071 | 3300011086 | Peatlands Soil | GLIYLTNNEGLWILRYNRPARLEPAKKKQPCDSESAIMAMPPDCD* |
Ga0138578_12031682 | 3300011110 | Peatlands Soil | WILRYNRPSMLEPAKKKPPCDSNSAIMAMPPDCD* |
Ga0150983_108196821 | 3300011120 | Forest Soil | LTNNEGLWILRYNHPSLLEPAKKKPPCDSNSEIMAMPPDYA* |
Ga0150983_159469032 | 3300011120 | Forest Soil | LIYLTNNEGLWILRYNRPPLLEPAKKKPPCDSESQIMAMPPDCD* |
Ga0150983_163726222 | 3300011120 | Forest Soil | WVLRYTRPALLEPAKKKRPCDSESEIEAMPPECD* |
Ga0181529_107380341 | 3300014161 | Bog | LTNNDGLWVLRYNRPAPLEPEKKKPLCDSNAEIMAMPPDCD* |
Ga0181534_108756551 | 3300014168 | Bog | HGLIYLTNNEGLWILRYNRPAPLEPAKKKPLCDSNAEIMAMPPDCD* |
Ga0187818_100434731 | 3300017823 | Freshwater Sediment | HGLIYLANTEGLWVLRYNRPALLEPAKKKPPCDSNSEIMAMPPDCD |
Ga0187801_103074072 | 3300017933 | Freshwater Sediment | LWILRYDRPSPLEPAKKKKPCDSESQIMAMPPDCD |
Ga0187808_102671191 | 3300017942 | Freshwater Sediment | NEGWWILRYSRPELLEPAKTKKPCDSESEIEAMPPECD |
Ga0187817_109978432 | 3300017955 | Freshwater Sediment | LWVLRYNHPSLLEPSKKKPPCDSNSEIMAMPPDCD |
Ga0187817_111085941 | 3300017955 | Freshwater Sediment | NNEGLWILRYDRPSPLEPAKKKKPCDSESQIMAMPPDCD |
Ga0187776_104847113 | 3300017966 | Tropical Peatland | LIYLTNNEGLWILRYKRLAMLEPARKKPPCDSYSAIMAMPPECE |
Ga0187781_104235272 | 3300017972 | Tropical Peatland | LIYLTNNDGLWILRYTRPPLLEPEKHKKPCDSESQIMAMPPDCD |
Ga0187891_10781671 | 3300017996 | Peatland | TNNEGLWILRYNRPSRLEPAKKKQPCDSESAIMAMPPDCD |
Ga0187815_100812091 | 3300018001 | Freshwater Sediment | TNNEGLWILRYNRPSMLEPARKKPPCDSESQIMAMPPDCD |
Ga0187857_101487921 | 3300018026 | Peatland | GLWVLRYNRPALLEPAKQKKPCSSESDIQAMPPDCD |
Ga0187862_106485082 | 3300018040 | Peatland | FLTNNEGLWVLRYNRPALLEPAKQKKPCSSESDIQAMPPDCD |
Ga0187871_102688471 | 3300018042 | Peatland | EGLWILRYNRPPLMEPARKKPACDSESAIMAMPPDCD |
Ga0187858_101407951 | 3300018057 | Peatland | NNEGLWILRYDRPSPLEPAKKKKPCDSETAIMAMPPDCD |
Ga0187772_100102518 | 3300018085 | Tropical Peatland | GHGLIYLTNDQGLWILRYNRPALLEPAKKKPPCTSESDIQAMPPDCD |
Ga0187772_103935611 | 3300018085 | Tropical Peatland | LWAPRYYRQPLLEPAKKKPPCDSESEIMAMPPDCD |
Ga0187772_107595382 | 3300018085 | Tropical Peatland | IYLTNSEGLWILRYTRPARLEPAKKKKPCDSNAILSAMPPDCD |
Ga0187769_104225471 | 3300018086 | Tropical Peatland | GLWILRYNRPAKLEPAKKKPPCDSNTEIMAMPPDCD |
Ga0184595_1075471 | 3300019166 | Soil | LTNNDGLWILRYNHPSRFEPAKKKPPCDSETEIQAMPPDCQ |
Ga0184595_1172691 | 3300019166 | Soil | LLPDSHRGLIFLTNNEGLWVLRYIRPALLEPAKHKKPCSSEADIQAMPPDCD |
Ga0184601_1233351 | 3300019183 | Soil | RGLIFLTNNEGLWVLRYIRPALLEPAKHKKPCSSEADIQAMPPDCD |
Ga0181504_11378612 | 3300019258 | Peatland | NNDGLYILRYNHPSRFEPAKKKPPCTSESEIQAMAPDCQ |
Ga0187798_13327271 | 3300019275 | Peatland | EGLWVLRYIRPARLEPAKKKPPCDSNAEIMAMPPDCD |
Ga0187800_14275011 | 3300019278 | Peatland | NDQGLWILRYSRPALLEPAKKKPPCDSESEIMAMPPDCD |
Ga0187797_18309991 | 3300019284 | Peatland | NDEGLWILKYNRQGRLDPAKKKPPCDSYSAIMSMPPDCD |
Ga0210403_101684004 | 3300020580 | Soil | GGHGLIYLTNNEGLWVLRYTRPALLEPAKKKRPCDSESEIESMPPECD |
Ga0210395_114133151 | 3300020582 | Soil | NNEGLWILRYTRPALLEPAKKKRPCDSESEIEAMPPECD |
Ga0210396_109590162 | 3300021180 | Soil | LVFLTNNEGLWILRYSHPSLLEPAKKKPPCDSNSEIAAMPPDCD |
Ga0210385_115003662 | 3300021402 | Soil | DDGLWILRYRHPWLFEPEKNKSPCTSESNIQAMPPDCQ |
Ga0210387_110897301 | 3300021405 | Soil | SLVFLTNNEGLWILRYSHPSLLEPAKKKPPCDSNSEIAAMPPDCD |
Ga0210392_102199121 | 3300021475 | Soil | FLTNNEGLWILRYSHPSLLEPAKKKPPCDSNSEIAAMPPDGD |
Ga0210410_106271501 | 3300021479 | Soil | IYLTNNEGLWILRYTRPALLEPAKKKRPCDSESEIEAMPPECD |
Ga0210409_114083912 | 3300021559 | Soil | LWILRYNHPSLLEPAKKKPPCDSNSEIMAMPPDCD |
Ga0242642_10557932 | 3300022504 | Soil | NEGLWILRYTRPALLEPAKKKRPCDSESEIEAMPPECD |
Ga0242649_10780921 | 3300022509 | Soil | NNEGLWILRYHRPAPLEPAKKKPPCDSNAEIMAMPPDCD |
Ga0242669_11380841 | 3300022528 | Soil | EGLWVLRYTRPALLEPAKKKRPCDSESEIESMPPECD |
Ga0242662_103324691 | 3300022533 | Soil | LIYLTNNEGLWILRYTRPALLEPAKKKRPCDSESEIEAMPPECD |
Ga0242674_10383221 | 3300022711 | Soil | NNEGLWVLRYTRPALLEPAKKKRPCDSESEIESMPPECD |
Ga0242673_11368932 | 3300022716 | Soil | TNNDGLWVLRYIRPALLEPAKKKPLCDSNAEIMAMPPECD |
Ga0242661_11515141 | 3300022717 | Soil | GLIYLTNNEGLWILRYSRAALLEPAKKKRPCDSESEIAAMPPDCD |
Ga0247550_1052341 | 3300023660 | Soil | LIFLTNNEGLWVLRYIRPALLEPAKHKKPCSSEADIQAMPPDCD |
Ga0208689_10234071 | 3300025459 | Peatland | LWILRYNRPLRLEPAKKKPPCDSESAIMAMPPDCD |
Ga0209736_12116741 | 3300027660 | Forest Soil | IYLTNNEGLWILRYNRPSLLEPSKKKVPCDSNSEISAMPPDCD |
Ga0209517_104167673 | 3300027854 | Peatlands Soil | LWILRYSRAALLEPAKKKKPCDSSSDISAMPPDCD |
Ga0209693_100504414 | 3300027855 | Soil | MYLTNNEGLWILRYHHPSLLEPAKKKPLCDSNSEIMAMPPDCD |
Ga0209380_100463435 | 3300027889 | Soil | GLWILRYNRPALLEPAKKKPPCDSNAEIMAMPPDCD |
Ga0209380_102857421 | 3300027889 | Soil | GLWILRYNRPALLEPAKKKPPCDSESAIMAMPPDCD |
Ga0209624_106073321 | 3300027895 | Forest Soil | GLIFLTNNEGLWVLRYIRPALLEPAKHKKPCSSEADIQAMPPDCD |
Ga0209168_101948573 | 3300027986 | Surface Soil | LIYLTNDEGLWILRYNHPSLLEPAKKKPPCDSNSEIMAMPPDCD |
Ga0302218_101443093 | 3300028863 | Palsa | GLWILRYTRPALLEPAKKKPPCDSESEIQAMPPDCQ |
Ga0311328_101125531 | 3300029939 | Bog | EGLWILRYNRPAPLEPTKKKPLCDSNAEIMAMPPDCD |
Ga0311340_115347882 | 3300029943 | Palsa | NSEGLWILRYNRPAPLEPARKKPPCDSESEIMAMPPDCD |
Ga0311338_107351841 | 3300030007 | Palsa | EGLWILRYNRPALLEPSKKKPPCDSESEIMAMPPDCD |
Ga0302179_105143191 | 3300030058 | Palsa | GLWILRYNRPALLEPSKKKPPCDSESEIMAMPPDCD |
Ga0302184_101595633 | 3300030490 | Palsa | NEGLWILRYNRPALFEPAKKKPLCDSNAEIMAMPPDCD |
Ga0265461_136275851 | 3300030743 | Soil | PDGGHGLIYLTNNEGLWILRYSRASLLEPAKKKRPCDSETEIMAMPPDCD |
Ga0265746_10377791 | 3300030815 | Soil | LIYLTNNDGLYILRYEHPSRLEPAKKKPPCDSEAEIQAMPPDCQ |
Ga0170823_150824352 | 3300031128 | Forest Soil | FYFYFSFIGLWILRYNHPSFLEPAKKKPPCDSNSEIMAMPPDCD |
Ga0310686_1044554381 | 3300031708 | Soil | LTNNDGLWILRYNRFSPLEPAKKKPLCDSESEIMAMPPDCE |
Ga0310686_1149939891 | 3300031708 | Soil | NNDGLWILRYNHPSLLEPAKKKPLCNSEAEIMAMPPDCQ |
Ga0307476_100327906 | 3300031715 | Hardwood Forest Soil | YLTNNEGLWVLRYSRASLLEPAKKKRPCDSETEIMAMPPDCD |
Ga0306925_120029601 | 3300031890 | Soil | NNEGLWILRYNRPALLEPARKKPACDSNAAIMAMPPECN |
Ga0316051_10282602 | 3300032119 | Soil | PDSHRGLIFLTNNEGLWVLRYIRPALLEPAKHKKPCSSEADIQAMPPDCD |
Ga0335077_101491551 | 3300033158 | Soil | TNSEGLWVLQYHRAGMLEPARKKPPCDSNAEIMAMPPDCD |
Ga0326727_107026291 | 3300033405 | Peat Soil | LIYLTNDDGLWVLRYNRPALLEPAKKKPPCDSESEIMAMPPDCD |
⦗Top⦘ |