Basic Information | |
---|---|
Family ID | F103663 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 46 residues |
Representative Sequence | MAHWMAEHEVLAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 31.68 % |
% of genes near scaffold ends (potentially truncated) | 19.80 % |
% of genes from short scaffolds (< 2000 bps) | 79.21 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.436 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.842 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.475 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF03572 | Peptidase_S41 | 6.93 |
PF14066 | DUF4256 | 5.94 |
PF07517 | SecA_DEAD | 4.95 |
PF02517 | Rce1-like | 4.95 |
PF13517 | FG-GAP_3 | 4.95 |
PF13180 | PDZ_2 | 2.97 |
PF04237 | YjbR | 2.97 |
PF14582 | Metallophos_3 | 0.99 |
PF13683 | rve_3 | 0.99 |
PF02371 | Transposase_20 | 0.99 |
PF00166 | Cpn10 | 0.99 |
PF01527 | HTH_Tnp_1 | 0.99 |
PF14022 | DUF4238 | 0.99 |
PF00902 | TatC | 0.99 |
PF00903 | Glyoxalase | 0.99 |
PF01839 | FG-GAP | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 6.93 |
COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 4.95 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 4.95 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 4.95 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.97 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.44 % |
Unclassified | root | N/A | 43.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_107346 | Not Available | 714 | Open in IMG/M |
2199352024|deeps__Contig_175120 | Not Available | 916 | Open in IMG/M |
3300002568|C688J35102_120902059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 2154 | Open in IMG/M |
3300003321|soilH1_10260224 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
3300003324|soilH2_10447776 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300004479|Ga0062595_100110917 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300004479|Ga0062595_100281132 | Not Available | 1106 | Open in IMG/M |
3300004479|Ga0062595_101008111 | Not Available | 716 | Open in IMG/M |
3300005186|Ga0066676_11158597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 507 | Open in IMG/M |
3300005336|Ga0070680_101608361 | Not Available | 563 | Open in IMG/M |
3300005338|Ga0068868_100479747 | Not Available | 1086 | Open in IMG/M |
3300005345|Ga0070692_10146490 | Not Available | 1341 | Open in IMG/M |
3300005345|Ga0070692_10270192 | Not Available | 1026 | Open in IMG/M |
3300005434|Ga0070709_10330831 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300005434|Ga0070709_10970992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300005434|Ga0070709_11125369 | Not Available | 629 | Open in IMG/M |
3300005435|Ga0070714_101118905 | Not Available | 768 | Open in IMG/M |
3300005436|Ga0070713_102087195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300005437|Ga0070710_10802049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300005439|Ga0070711_100115118 | Not Available | 1980 | Open in IMG/M |
3300005458|Ga0070681_10212900 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
3300005530|Ga0070679_101115389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300005533|Ga0070734_10007785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8512 | Open in IMG/M |
3300005533|Ga0070734_10338865 | Not Available | 859 | Open in IMG/M |
3300005535|Ga0070684_100180106 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300005537|Ga0070730_10078117 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300005537|Ga0070730_10717686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 633 | Open in IMG/M |
3300005539|Ga0068853_100048630 | All Organisms → cellular organisms → Bacteria | 3643 | Open in IMG/M |
3300005542|Ga0070732_10045946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2517 | Open in IMG/M |
3300005542|Ga0070732_10154937 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300005542|Ga0070732_10427944 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300005547|Ga0070693_100066298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2113 | Open in IMG/M |
3300005568|Ga0066703_10284278 | Not Available | 1002 | Open in IMG/M |
3300005575|Ga0066702_10220562 | Not Available | 1153 | Open in IMG/M |
3300005575|Ga0066702_10690592 | Not Available | 609 | Open in IMG/M |
3300005575|Ga0066702_10921963 | Not Available | 521 | Open in IMG/M |
3300006028|Ga0070717_10777459 | Not Available | 871 | Open in IMG/M |
3300006028|Ga0070717_11357576 | Not Available | 646 | Open in IMG/M |
3300006175|Ga0070712_100680614 | Not Available | 876 | Open in IMG/M |
3300007788|Ga0099795_10120166 | Not Available | 1050 | Open in IMG/M |
3300009093|Ga0105240_10163914 | Not Available | 2638 | Open in IMG/M |
3300009098|Ga0105245_10014319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6911 | Open in IMG/M |
3300009143|Ga0099792_10041269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2202 | Open in IMG/M |
3300009143|Ga0099792_10110473 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300009174|Ga0105241_10709565 | Not Available | 919 | Open in IMG/M |
3300009545|Ga0105237_10650122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
3300009551|Ga0105238_10020903 | All Organisms → cellular organisms → Bacteria | 6668 | Open in IMG/M |
3300009551|Ga0105238_11331788 | Not Available | 744 | Open in IMG/M |
3300010159|Ga0099796_10187711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300010361|Ga0126378_11647106 | Not Available | 729 | Open in IMG/M |
3300010373|Ga0134128_10177693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 2402 | Open in IMG/M |
3300010373|Ga0134128_10454502 | Not Available | 1429 | Open in IMG/M |
3300010373|Ga0134128_10869761 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300010373|Ga0134128_11406997 | Not Available | 768 | Open in IMG/M |
3300010375|Ga0105239_10517133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1358 | Open in IMG/M |
3300010375|Ga0105239_12216741 | Not Available | 639 | Open in IMG/M |
3300010396|Ga0134126_11923488 | Not Available | 647 | Open in IMG/M |
3300010396|Ga0134126_12977775 | Not Available | 512 | Open in IMG/M |
3300010399|Ga0134127_10447775 | Not Available | 1290 | Open in IMG/M |
3300011269|Ga0137392_10619040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
3300011271|Ga0137393_10657110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
3300012683|Ga0137398_10075221 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300012917|Ga0137395_10121644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1759 | Open in IMG/M |
3300012924|Ga0137413_10420795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300012930|Ga0137407_10887130 | Not Available | 843 | Open in IMG/M |
3300012957|Ga0164303_10695989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 684 | Open in IMG/M |
3300012960|Ga0164301_10269095 | Not Available | 1130 | Open in IMG/M |
3300012960|Ga0164301_11148052 | Not Available | 621 | Open in IMG/M |
3300012971|Ga0126369_10864557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
3300012984|Ga0164309_10459800 | Not Available | 964 | Open in IMG/M |
3300012986|Ga0164304_10060303 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300012986|Ga0164304_10607807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300012986|Ga0164304_11199512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300013296|Ga0157374_12867850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300015242|Ga0137412_10507873 | Not Available | 922 | Open in IMG/M |
3300015264|Ga0137403_11146074 | Not Available | 623 | Open in IMG/M |
3300018468|Ga0066662_10465366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1138 | Open in IMG/M |
3300020140|Ga0179590_1051359 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300021170|Ga0210400_10013624 | All Organisms → cellular organisms → Bacteria | 6477 | Open in IMG/M |
3300021170|Ga0210400_10401711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
3300021560|Ga0126371_10389973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1533 | Open in IMG/M |
3300024288|Ga0179589_10135791 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300025912|Ga0207707_10386528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
3300025912|Ga0207707_10497566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
3300025913|Ga0207695_11582761 | Not Available | 536 | Open in IMG/M |
3300025921|Ga0207652_11713370 | Not Available | 533 | Open in IMG/M |
3300025924|Ga0207694_10012058 | All Organisms → cellular organisms → Bacteria | 6517 | Open in IMG/M |
3300025924|Ga0207694_10105305 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
3300025927|Ga0207687_10012353 | All Organisms → cellular organisms → Bacteria | 5583 | Open in IMG/M |
3300025949|Ga0207667_11913404 | Not Available | 555 | Open in IMG/M |
3300026041|Ga0207639_11900796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 556 | Open in IMG/M |
3300027583|Ga0209527_1108079 | Not Available | 623 | Open in IMG/M |
3300027738|Ga0208989_10238665 | Not Available | 595 | Open in IMG/M |
3300027826|Ga0209060_10005952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8537 | Open in IMG/M |
3300027842|Ga0209580_10004261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6093 | Open in IMG/M |
3300027842|Ga0209580_10389197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300027903|Ga0209488_10005003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10239 | Open in IMG/M |
3300027903|Ga0209488_10338266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
3300031122|Ga0170822_15132768 | Not Available | 574 | Open in IMG/M |
3300031231|Ga0170824_116501905 | Not Available | 1112 | Open in IMG/M |
3300031938|Ga0308175_102318520 | Not Available | 602 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.88% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 9.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_01906090 | 2199352024 | Soil | MAHWMAEHEILAAVIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS |
deeps_03253200 | 2199352024 | Soil | VMAHWMAEHEVLAAAIFVALSLALTAIFAALERHYQQQLAVRGKNDFS |
C688J35102_1209020593 | 3300002568 | Soil | MAHWMAEHEILSAVIFVGLSLALIAFFAALERRYKEQLTARRKDYFL* |
soilH1_102602242 | 3300003321 | Sugarcane Root And Bulk Soil | MAHWMAEHEILAAIIFVGLSLTLTAIFAALERRYKHELTARRKDNLS* |
soilH2_104477762 | 3300003324 | Sugarcane Root And Bulk Soil | MAHWMAEHEILAAIIFVGLSLALTAIFAALERRYKHELTARRKDNLS* |
Ga0062595_1001109171 | 3300004479 | Soil | MAHWMAQHEILAAVIFVGLSLALIAFFATLERRYKEHLMTRRKDYL* |
Ga0062595_1002811321 | 3300004479 | Soil | MAHWMAEHEVLAATIFVGLSLALTAIFAAMERRYKQQLTARRKNNFS* |
Ga0062595_1010081111 | 3300004479 | Soil | MAEHEVLAAAIFVGLSLALTAIFAALERRYKQQLTARRKDNFS* |
Ga0066676_111585971 | 3300005186 | Soil | MAEHEILSAVIFVGLSLALIAFFAALERRYKEQLTARRKD |
Ga0070680_1016083611 | 3300005336 | Corn Rhizosphere | MAHWMAEHEAFAAAIFVGLSLALIAIFAAMEHRYKQKLTARRKDYFS* |
Ga0068868_1004797471 | 3300005338 | Miscanthus Rhizosphere | MAQWMAEHEVLAAAFFVGLSVALIVIFAALERRYKEQLTARRKDRFS* |
Ga0070692_101464901 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMAEHEVLAAAIFVGLSLALIALFSALERRYKEQLTSRRKNYFS* |
Ga0070692_102701922 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMAEHEAFAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFT* |
Ga0070709_103308312 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMAEHEVLAAAIFVGLSLALIALFAALERRYKEQLTSRRKNDFF* |
Ga0070709_109709922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMAEHEILAAAMFVGLSLALIALFAALERRYKEQLTSRRKNYFS* |
Ga0070709_111253691 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQWMAEHEIMAAAVFVGLSLALIAIFAALEHRYKEQLTARRKDYFS* |
Ga0070714_1011189053 | 3300005435 | Agricultural Soil | MAHWMAEHEVLAAAIFVGLSLALIALFAALERRYKEQLTSRRKNDFS* |
Ga0070713_1020871951 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPFGMAHWMAEHEILAAAAFVGLSLALIAFFAALERRYKEQLTSRRKSYFS* |
Ga0070710_108020491 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMADHEVLAAALFVGLSLALIAFFAALERRYKEQLTSRRKNYFS* |
Ga0070711_1001151181 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQWMAEHEVLAAAIFVGLSLALIAIFAALEHRYKEELTARRKDHFS* |
Ga0070681_102129002 | 3300005458 | Corn Rhizosphere | MAHWMAQHEVLAAAIFVGLSLALIALFAALERRYKEQLTSRRKSYFS* |
Ga0070679_1011153892 | 3300005530 | Corn Rhizosphere | MAHWMAEHEAFAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS* |
Ga0070734_100077859 | 3300005533 | Surface Soil | MAHWMAEHEVLAAAIFVALSFALTAFFAALERHYEQQLTSRRKNDFS* |
Ga0070734_103388652 | 3300005533 | Surface Soil | MAHWMAEHEIMAAVVFVGLSLALIAIFAALEHRYKQQLTARRKNYYS* |
Ga0070684_1001801062 | 3300005535 | Corn Rhizosphere | MAQWMAEHEVLAAAFFVGLSVALIVIFAALERRYKEQLTARRKDHFS* |
Ga0070730_100781172 | 3300005537 | Surface Soil | MAHWMAEHEVLAAAIFVALSFALTAFFAALERHYEQQFTSRRKNDFS* |
Ga0070730_107176862 | 3300005537 | Surface Soil | MAHWMAEHEVLAAAIFVGLSLALIAIFAALEHRYK |
Ga0068853_1000486304 | 3300005539 | Corn Rhizosphere | MAQWMAEHEVLAAAFFVGLSVALIVIFAALERRYKEQLTARRKDYFS* |
Ga0070732_100459461 | 3300005542 | Surface Soil | HTPYAYGMAHWMAEHEVLAAAIFVGLSLALTAFFSALERHYKQQLTSRRKNDFS* |
Ga0070732_101549372 | 3300005542 | Surface Soil | MAHWMAEHEVLAAAVFVAVSLALTAVFAALERHYKQQLTSRRKNNFS* |
Ga0070732_104279442 | 3300005542 | Surface Soil | MAHWMAEHEVLAAAVFVAVSLALTAIFAALERHYKQQLTSRRKNNFS* |
Ga0070693_1000662982 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQWMAEHEVLAAAFFVGLSLALIVIFAALERRYKEQLTARRKDHFS* |
Ga0066703_102842782 | 3300005568 | Soil | MAQWMAEHEVLAAVIFVGLSLALIAIFAALEHRYKQQLTTRRKDYFS* |
Ga0066702_102205621 | 3300005575 | Soil | MAQWMAEHEVLAAVIFVGLSLALIAIFAALEHRYKQQLTARREDYFS* |
Ga0066702_106905922 | 3300005575 | Soil | MAHWMAEHEVLAAAIFVGLSLGLIAIFAALEHRYKQQLTARRKDYFS* |
Ga0066702_109219632 | 3300005575 | Soil | MAHWMAEHEILAAAIFVGLSLALIAFFAALERRYKEQLASR |
Ga0070717_107774591 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHWMAEHEILAAAVFVGLSLALIALFAALERRYKEQLTSRRKNDFS* |
Ga0070717_113575761 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | WMAEHEVLAAAIFVGLSLALIAIFAALEHRYKEELTARRKDHFS* |
Ga0070712_1006806142 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEHEIMAAAVFVGLSLALIAIFAALEHRYKQQLTARRKDYFS* |
Ga0099795_101201661 | 3300007788 | Vadose Zone Soil | MNQHEILAAVIFVGLSLALISFFAALARRDKGQLTSRRKNY |
Ga0105240_101639143 | 3300009093 | Corn Rhizosphere | MAHWMAEHEVLAAAIFVGLSLALTAFFAVLERHYKQPLTSRRKNYFS* |
Ga0105245_100143192 | 3300009098 | Miscanthus Rhizosphere | MAHWMAEHEILAAAIFVGLSLALIGFFAALERRYKEQLTSRRKNYFS* |
Ga0099792_100412693 | 3300009143 | Vadose Zone Soil | MASWMNQHEILAAVIFVGLSLALIAFFAALERRYKGQLTSRRKNYFP* |
Ga0099792_101104732 | 3300009143 | Vadose Zone Soil | MAEHEVLAAGIFVGLSLALIALFAALEQRYKKQLTSRRKNYFS* |
Ga0105241_107095652 | 3300009174 | Corn Rhizosphere | MAEHEVLAAAIFVGLSLALTAIFAALERRYKQQLTARQKDNFS* |
Ga0105237_106501222 | 3300009545 | Corn Rhizosphere | FGMAHWMAQHEVLAAAIFVGLSLALIALFAALERRYKEQLTSRRKSYFS* |
Ga0105238_100209031 | 3300009551 | Corn Rhizosphere | MAQWMAEHEVLAAAFFVGLSLALIVIFAALERRYKGQLTARRKDHFS* |
Ga0105238_113317882 | 3300009551 | Corn Rhizosphere | AAFFVGLSVALIVIFAALERRYKEQLTARRKDHFS* |
Ga0099796_101877112 | 3300010159 | Vadose Zone Soil | MNQHEILAAVIFVGLSLALIAFFAALERRYKGQLTSRRKNYFP* |
Ga0126378_116471061 | 3300010361 | Tropical Forest Soil | MAQWMAEHEVLAAAVFVALSLAITAIFAALERRYGEQ |
Ga0134128_101776933 | 3300010373 | Terrestrial Soil | MAQWMAEHEVLAAALFVGLSLALIAVFAVLEHRYKDELTARRKDNFS* |
Ga0134128_104545022 | 3300010373 | Terrestrial Soil | MAHWMAEHEVLAAAIFVAISLALTAIFAALERHYQQQLAVRGKNDFS* |
Ga0134128_108697611 | 3300010373 | Terrestrial Soil | MAHWMAQHEILAAVIFVGLSLALIAFFATLERRYKEHLMTRRKD |
Ga0134128_114069972 | 3300010373 | Terrestrial Soil | EHEALAAAIFVALSLALIAVFAAVERHYKEQLTSSRKNYFS* |
Ga0105239_105171332 | 3300010375 | Corn Rhizosphere | MAHWMAKNEVLSAVVFVGLSLARIALFAALERRYKERLASRRKDYFS* |
Ga0105239_122167412 | 3300010375 | Corn Rhizosphere | MADWMAEHEVLAAAIFVGLSLALTAIFAALERRYKQQLTARRKDNFS* |
Ga0134126_119234881 | 3300010396 | Terrestrial Soil | MAQCMAEHEVLAAAIFVGLSLALIAIFAALEHRYKEELTARRKDHFS* |
Ga0134126_129777752 | 3300010396 | Terrestrial Soil | MAHWMAQHEILAAVIFVGLSLALIAFFATLERRYKEHMMTRRKDYL* |
Ga0134127_104477753 | 3300010399 | Terrestrial Soil | MAQWMAEHEVLAAAFFVGLSLALIVIFAALERRYKEQLTARRKDYFS* |
Ga0137392_106190401 | 3300011269 | Vadose Zone Soil | MASWMNQHEILAAVIFVGLSLALIAFFAALERRYKEQLTSRRKNYFP* |
Ga0137393_106571102 | 3300011271 | Vadose Zone Soil | MASWMNQHEILAAVIFVGLSLALIAFFAALERRYKEQLTSRRKNYFS* |
Ga0137398_100752212 | 3300012683 | Vadose Zone Soil | MSEHEVLAAAVFVGLSLALTVFFAFLERRYKQQLTGAAKIKLDK* |
Ga0137395_101216442 | 3300012917 | Vadose Zone Soil | MNQHEILAAVIFVGLSLALIAFFAALERRYKEQLTSRRKNYFS* |
Ga0137413_104207952 | 3300012924 | Vadose Zone Soil | MAHWMAEHETLAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS* |
Ga0137407_108871302 | 3300012930 | Vadose Zone Soil | MASWMNQHEILAAAISVGVSLALIAFFAALERRYKEQLTGRRKG* |
Ga0164303_106959892 | 3300012957 | Soil | MAHWMADHEILAAAIFVGLSLALIGFFAALERRYKEQLTSRRKNYFS* |
Ga0164301_102690952 | 3300012960 | Soil | MAHWMAEHEIMAAVVFVGLSLALIAIFAALEHRYKEQLTARRKDYFS* |
Ga0164301_111480522 | 3300012960 | Soil | MAQWMAEHEIMAAAVFVGLSLALIAIFASLEHRYKQQLTARRKDYFS* |
Ga0126369_108645572 | 3300012971 | Tropical Forest Soil | MAHWMAQHEVFAAAVFVALSLAITAIFAALERRYGEQITARRKDNYS* |
Ga0164309_104598002 | 3300012984 | Soil | EVLAAAIFVGLSLALIAIFAALEHRYKEELTARRKDHFS* |
Ga0164304_100603031 | 3300012986 | Soil | MAQWMAEHEIMAAVVFVGLSLALIAIFAALEHRYKEQLTARRKDYFS* |
Ga0164304_106078072 | 3300012986 | Soil | AGNQSILPSGMAHWMAEHEILAAAIFVGLSLALIGFFAALERRYKEQLTSRRKNYFS* |
Ga0164304_111995121 | 3300012986 | Soil | MAHWMAENEVLAAALFVALSLALTAFFAALERHYEQQLTSRRKNNFS* |
Ga0157374_128678501 | 3300013296 | Miscanthus Rhizosphere | WMAEHEVLAAAIFVGLSLALIALFSALERRYKEQLTSRRKNYFS* |
Ga0137412_105078732 | 3300015242 | Vadose Zone Soil | MNQHEVLAAAIFVGVSLALMAFFSALERRYKERLTSCRKNEIP* |
Ga0137403_111460742 | 3300015264 | Vadose Zone Soil | MNQHEILAAAVFVGLSLALIAFFAALERRYKEQLTGRRKD* |
Ga0066662_104653661 | 3300018468 | Grasslands Soil | MAHWMAEHEVLAAAIFVGLSLGLIAIFAALEHRYKQQLTARRKDYFS |
Ga0179590_10513592 | 3300020140 | Vadose Zone Soil | MNQHEVLAAAIFVGVSLALMAFFSALERRYKQQLTSCRKNEIP |
Ga0210400_100136246 | 3300021170 | Soil | MNQHEILAAALFVGLSLALTVFFAALERRYKQQLTSPRKNYFSE |
Ga0210400_104017111 | 3300021170 | Soil | MSQHEALAAVIFVGLSLALIAFFAALERRYKKQLTSPRKNYFSERAP |
Ga0126371_103899732 | 3300021560 | Tropical Forest Soil | MAQWMVEHEILAAAIFVGLSLALVAIFAALEHRYKKQLTARRKDHFS |
Ga0179589_101357912 | 3300024288 | Vadose Zone Soil | MNQHEVLAAAIFVGVSLALMAFFSALERRYKQQLTSSRKNEI |
Ga0207707_103865282 | 3300025912 | Corn Rhizosphere | MAHWMAEHEVLAAAIFVGLSLALIALFSALERRYKEQLTSRRKNYFS |
Ga0207707_104975662 | 3300025912 | Corn Rhizosphere | MAHWMAQHEVLAAAIFVGLSLALIALFAALERRYKEQLTSRRKSYFS |
Ga0207695_115827611 | 3300025913 | Corn Rhizosphere | MAHWMAQHEILAAVIFVGLSLALIAFFATLERRYKEHLMTRRKDYL |
Ga0207652_117133701 | 3300025921 | Corn Rhizosphere | MAEHEAFAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS |
Ga0207694_100120583 | 3300025924 | Corn Rhizosphere | MAHWMAEHEVLAAAIFVGLSLALTAFFAVLERHYKQPLTSRRKNYFS |
Ga0207694_101053054 | 3300025924 | Corn Rhizosphere | MAQWMAEHEVLAAAFFVGLSLALIVIFAALERRYKEQLTARRKDYFS |
Ga0207687_100123531 | 3300025927 | Miscanthus Rhizosphere | MAHWMAEHEILAAAIFVGLSLALIGFFAALERRYKEQLTSRRKNYFS |
Ga0207667_119134041 | 3300025949 | Corn Rhizosphere | FYAYVMAHWMAEHEVLAAAIFVAISLALTAIFAALERHYQQQLAVRGKNDFS |
Ga0207639_119007961 | 3300026041 | Corn Rhizosphere | MAEHEVLAAAIFVGLSLALIALFSALERRYKEQLTSRRKN |
Ga0209527_11080792 | 3300027583 | Forest Soil | MNQHEVLAAVIFVGLSLAITVLFSFLERRYQRKLTGRRQDKSHQQMG |
Ga0208989_102386651 | 3300027738 | Forest Soil | MTEHEVLAAVAFVGLSLALTVFFAALERRYKRELTDRSNKYTP |
Ga0209060_100059522 | 3300027826 | Surface Soil | MAHWMAEHEVLAAAIFVALSFALTAFFAALERHYEQQLTSRRKNDFS |
Ga0209580_100042616 | 3300027842 | Surface Soil | MAHWMAEHEVLAAAVFVAVSLALTAVFAALERHYKQQLTSRRKNNFS |
Ga0209580_103891972 | 3300027842 | Surface Soil | MAHWMAEHEVLAAAIFVGLSLALTAFFSALERHYKQQLTSRRKNDFS |
Ga0209488_100050033 | 3300027903 | Vadose Zone Soil | MASWMNQHEILAAVIFVGLSLALIAFFAALERRYKGQLTSRRKNYFP |
Ga0209488_103382662 | 3300027903 | Vadose Zone Soil | MAHWMTEHEVLAAGIFVGLSLALIALFAALEQRYKKQLTSRRKNYFS |
Ga0170822_151327682 | 3300031122 | Forest Soil | MAHWMVEHEVLAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS |
Ga0170824_1165019051 | 3300031231 | Forest Soil | MAHWMAEHEVLAAAIFVGLSLALIAIFAALEHRYKQQLTARRKDYFS |
Ga0308175_1023185201 | 3300031938 | Soil | MAEHEALAAAIFVALSLALIAIFAALERHYKQPLTSRRKNYFS |
⦗Top⦘ |