Basic Information | |
---|---|
Family ID | F103733 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 47 residues |
Representative Sequence | IDFDVFNVLNAATPTAANFQSGPSFGYVTNVIPARIARLGVRFRF |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.99 % |
% of genes from short scaffolds (< 2000 bps) | 0.99 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.010 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.852 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.485 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.59% β-sheet: 0.00% Coil/Unstructured: 90.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF09656 | PGPGW | 0.99 |
PF00507 | Oxidored_q4 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.01 % |
All Organisms | root | All Organisms | 0.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005536|Ga0070697_101955892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.99% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0063454_1009555251 | 3300004081 | Soil | RFEIDFDVFNVLNAATATGANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0062591_1024866411 | 3300004643 | Soil | FDVFNVLNAATPTGANFQSGPSFGYVTGVIPARIARLGARFRF* |
Ga0066673_105806642 | 3300005175 | Soil | GAGTRLAIDFDVFNVFNAATATNANFQAGPSFGYITGVIPARIARLGARFRF* |
Ga0066679_107285472 | 3300005176 | Soil | FEVDVDVFNVLNAATPTGANFQSGPTFGYVTGVIPARIARLSGRFRF* |
Ga0066684_110864152 | 3300005179 | Soil | VFNALNAATPTGAQFQSGPSFGFVTGVIPARIARLGLRFRF* |
Ga0066671_103528421 | 3300005184 | Soil | LDIDFDVFNALNAATPTGAQFQSGPSFGFVTGVIPARIARLGLRFRF* |
Ga0066675_110909932 | 3300005187 | Soil | DVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGVRFLF* |
Ga0065705_110304201 | 3300005294 | Switchgrass Rhizosphere | GGGRRLNFDVDVFNVLNAATPTAATFVTGPSFGYTSSVIPARIARLGVRFLF* |
Ga0070690_1006381932 | 3300005330 | Switchgrass Rhizosphere | LGGSRRFEIDFDVFNVLNAATPTGANFQSGPSFGYVTGVIPARIARLGARFRF* |
Ga0070680_1004423501 | 3300005336 | Corn Rhizosphere | SKDISLGGSRHLDIDFDVFNVLNAATPTAANFQSGPSFGYITGVLPARIARLGARFRF* |
Ga0070673_1014185041 | 3300005364 | Switchgrass Rhizosphere | LNIDVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0066681_104327922 | 3300005451 | Soil | FNVLNAATPTNANFQSGPSFGYVTGVIPARIARLGVRFLF* |
Ga0066687_109810842 | 3300005454 | Soil | RRFEIDVDVFNVLNAAAPTGANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0070706_1018530462 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IDFDVFNVLNAATPTGANFQTGPSFGFITGVIPARIARLGGRFRF* |
Ga0070707_1023386201 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0073909_102065771 | 3300005526 | Surface Soil | LKLGGSRRLNIDVDVFNVLNAATPTAATFVTGPSFGYTSSVIPARIARLGVRYVF* |
Ga0070697_1019558922 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SIGGGRRFEIDVDVFNVLNAATPTGANFQAGPSFGFVTGVIPARIARLGARFRF* |
Ga0070672_1007244452 | 3300005543 | Miscanthus Rhizosphere | TGRRLNIDVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0070695_1014854461 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVFNVLNAATPTNANFQSGPTFGYVTGVIPARIARLGVRFRF* |
Ga0066707_108645281 | 3300005556 | Soil | LNAATPTGAQFQSGPSFGFVTGVIPARIARLGLRFRF* |
Ga0066708_106716881 | 3300005576 | Soil | LDFDIFNVLNAATPTSANFQSGPTFGYVTNVIPARIARLGLRFRF* |
Ga0070702_1015541921 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | SKEFKLAMGRLNIHVDVFNVLNAATPTAATFVTGPSFGYTTSVIPARIARLGLRYVF* |
Ga0068859_1003923851 | 3300005617 | Switchgrass Rhizosphere | IDVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0068859_1005944831 | 3300005617 | Switchgrass Rhizosphere | VFNVLNAATPTNANFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0066905_1008549391 | 3300005713 | Tropical Forest Soil | DFSLGAARRVDVDLDVFNVLNAATPTAANFQSGPSFGFVTGVIPARIARLGVRFRF* |
Ga0066903_1015036122 | 3300005764 | Tropical Forest Soil | GSKQLSMGGSRRLDLDFDLFNVLNAATATGATFASGPTFGFVTGVIPARIARLGVRFRF* |
Ga0068858_1023346111 | 3300005842 | Switchgrass Rhizosphere | ATPTNATFVTGPTFGYTSSVIPARIARLGVRFLF* |
Ga0070716_1016216182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SKGFSLGADRRFEIDVDVFNVLNAATPTSANFQSGPSFGYITGVIPARIARLGVRFRF* |
Ga0079222_104434642 | 3300006755 | Agricultural Soil | GGGRRFEIDFDVFNVLNAATPTGANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0066665_100746781 | 3300006796 | Soil | GGRRLDVDVDVFNVLNAATPTAANFQSGPSFGYVTNVIPARIARLGVRFRF* |
Ga0075428_1006157591 | 3300006844 | Populus Rhizosphere | MPYRGAAFVTGPSFGYTSSVIPARTARLGVRFLF* |
Ga0075421_1019438782 | 3300006845 | Populus Rhizosphere | IDLDVFNVLNAATPTRAQFQAGPSFGFVTSVLPARIARLGGRFRF* |
Ga0075434_1003706192 | 3300006871 | Populus Rhizosphere | GGGRRFEIDVDVFNVLNAATPTGANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0075434_1009015992 | 3300006871 | Populus Rhizosphere | IDFDVFNVLNAATPTAANFQSGPSFGYVTNVIPARIARLGVRFRF* |
Ga0075434_1017386722 | 3300006871 | Populus Rhizosphere | RRLGIDFDVFNALNAATPTGATFASGPTFGYVTGVVPARIARLGARFTF* |
Ga0075424_1008106921 | 3300006904 | Populus Rhizosphere | DVFNVLNAATPTGANFQSGPSFGFVTGVIPARIARFGARLRF* |
Ga0075424_1020868671 | 3300006904 | Populus Rhizosphere | FDVFNALNAATPTGATFASGPTFGYVTGVVPARIARLGARFTF* |
Ga0075424_1021723172 | 3300006904 | Populus Rhizosphere | DFDVFNVLNAATPTAANFQSGPSFGYVTNVIPARIARLGVRFRF* |
Ga0079219_112881351 | 3300006954 | Agricultural Soil | AATPTAANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0075435_1016421031 | 3300007076 | Populus Rhizosphere | VDVFNVLNAATPTSANFQSGPSFAYVTGVIPARIARLGARFRF* |
Ga0066710_1004706261 | 3300009012 | Grasslands Soil | RRLDIDFDVFNALNAATPTGAKFESGPSFGFVTGVIPARIARLGLRFRF |
Ga0066710_1027668402 | 3300009012 | Grasslands Soil | NAATPTSANFQSGPSFGYVTNVIPARIARLGVRFRF |
Ga0099827_118295961 | 3300009090 | Vadose Zone Soil | NVLNAATPTNANFQSGPSFGYVTNVIPARIARLGVRFRF* |
Ga0079224_1003010994 | 3300009095 | Agricultural Soil | MRGRTFTLVSVDVFNVVNTNAVTGAQFSSGPTFGYAQDVIPARIARIGVRFEF* |
Ga0114129_113437942 | 3300009147 | Populus Rhizosphere | DVFNVLNAATATAANFQAGPSFGYVTNVIPARIARLGVRFRF* |
Ga0111538_133940611 | 3300009156 | Populus Rhizosphere | AATPTSANFQAGPSFGYVTNVIPARIARLGVRFRF* |
Ga0114970_103829182 | 3300009163 | Freshwater Lake | RRLDIDLDVFNVLNAATPTAATFQAGPTFGYITGVIPARIARAGVRLRF* |
Ga0105249_134656622 | 3300009553 | Switchgrass Rhizosphere | VKLGSGRRLNIDVDVFNVLNAATPTAANFQTGPSFGYVTSVIPARIARLGVRFLF* |
Ga0105856_12669771 | 3300009662 | Permafrost Soil | DVFNVLNAATPTAANFVTGSAFGFVSSVIPARIARLGVRFLF* |
Ga0126374_106052212 | 3300009792 | Tropical Forest Soil | FNVLNAATPTAANFQSGPSFGYVTGVIPARIARLGARFRF* |
Ga0134080_102910232 | 3300010333 | Grasslands Soil | VDVDVDVFNVLNAATPTNANFQSGPSFGYVTGVIPARIARLGVRFLF* |
Ga0134071_102738982 | 3300010336 | Grasslands Soil | MRLGIDADVFNVLNAATPTNANFQSGPSFGYITGVIPARIARLGARFSF* |
Ga0126378_109683142 | 3300010361 | Tropical Forest Soil | ERWKAAIDLDVFNLLNEATPLGANWSSGPTFGYVTDVIPGRIARIGVKFEF* |
Ga0134122_103802092 | 3300010400 | Terrestrial Soil | GGRRFEIDFDLFNVLNAATPTGANFQSGPSFGFVTGVIPARIARLGARFRF* |
Ga0137392_106281592 | 3300011269 | Vadose Zone Soil | VFNVLNTNAPTAATFASGLTFGYVTGVIPARIARIAARFRF* |
Ga0137393_116978552 | 3300011271 | Vadose Zone Soil | DFDVFNVLNTNAPTAATFASGLTFGYVTGVIPARIARIAARFRF* |
Ga0137388_112052832 | 3300012189 | Vadose Zone Soil | NVLNAATPTNANFQSGPSFGYVTGVIPARIARLGVRFRF* |
Ga0137374_109744942 | 3300012204 | Vadose Zone Soil | LNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF* |
Ga0137377_100861362 | 3300012211 | Vadose Zone Soil | VDVDIFNVLNAATPTQANFQAGPSFGYVTNVIPARIARLGVRFRF* |
Ga0150985_1108130472 | 3300012212 | Avena Fatua Rhizosphere | RRLGIDVDLFNALNVATPTAATFASGPTFGYVTDVVPGRIARIGGKLTF* |
Ga0137370_107749812 | 3300012285 | Vadose Zone Soil | RLDIDVDLFNALNAATPTGATFGAGPTFGYVNGVTPARIARLGLRFRF* |
Ga0137384_109684931 | 3300012357 | Vadose Zone Soil | KDFSLGGARRFEIDVDVFNVLNAATPTNANFQSGPSFGFITGVIPARIARLGARFRF* |
Ga0150984_1169336211 | 3300012469 | Avena Fatua Rhizosphere | VFNLLNAATPTGANFQSGPSFGYVTGVIPGRIARLGGRFRF* |
Ga0150984_1221339441 | 3300012469 | Avena Fatua Rhizosphere | TKGIAVGGSRRLGIDVDLFSALNLATPTNATFASGPTFGYVTDVVPGRIARIGGKLTF* |
Ga0157288_101598162 | 3300012901 | Soil | KLGGGRRLNIDVDVFNVLNAATPTAATFVTGPSFGYTSSVIPARIARLGVRFMF* |
Ga0137394_106587422 | 3300012922 | Vadose Zone Soil | DIDVDLFNVLNAATPTTANFQSGPSFGYVTNVIPARIARVGARFRF* |
Ga0137394_109571052 | 3300012922 | Vadose Zone Soil | RIDVDVDVFNVLNAATPTSANFQSGPSFGYVTNVIPARIARLGVRFRF* |
Ga0137359_111830331 | 3300012923 | Vadose Zone Soil | RAGKDFSLGGARRIDVDVDVFNVLNAATPTSANFQSGPSFGYVTNVIPARIARLGVRFRF |
Ga0137359_117418091 | 3300012923 | Vadose Zone Soil | RRFEIDVDVFNVLNAATPTGANFQAGPSFGFVTGVIPARIARLGARFRF* |
Ga0137407_109630622 | 3300012930 | Vadose Zone Soil | IDVDVFNVLNAATPTQANFQSGPSFGYVTGVIPARIARLGARFLF* |
Ga0164303_111966032 | 3300012957 | Soil | DVFNVLNAATPTNANFQSGPTFGYVTGVIPARIARLAVRFLF* |
Ga0137420_14919188 | 3300015054 | Vadose Zone Soil | LNAATPTLASFVTGPSFGFVSSVTPARIARLGLRFLF* |
Ga0132255_1029472112 | 3300015374 | Arabidopsis Rhizosphere | VFNVLNAATPTSANFQAGPSFGYVTNVIPARIARLGVRFRF* |
Ga0182036_109389721 | 3300016270 | Soil | AATPTAATFVTGPSFGYTTSVIPARIARLGVRYVF |
Ga0182034_108586272 | 3300016371 | Soil | FNVFNAATPTGANFQSGPTFGYVTGVIPARIARLGARFRF |
Ga0184625_106300851 | 3300018081 | Groundwater Sediment | SKDLKLGTGRRLNIDVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF |
Ga0066667_113900761 | 3300018433 | Grasslands Soil | IDLDVDVFNVLNAATPTSANFQAGPSFGYVTNVIPARIARLGGGFRF |
Ga0066669_111568782 | 3300018482 | Grasslands Soil | GAGTRLAIDFDVFNVFNAATPTNANFQAGPSFGYITGVIPARIARLGARFRF |
Ga0210382_104217861 | 3300021080 | Groundwater Sediment | DLFNVLNAATPTNATFVTGPSFGYTSSVIPARIARLGVRFVF |
Ga0207653_103529081 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | DVFNVLNAATPTNANFQSGPSFGYVTGVIPARIARLGVRFRF |
Ga0207688_101708362 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VFNLLNAATPTAATFVTGPSFGYTSSVIPARIARLGVRFLF |
Ga0207652_109173752 | 3300025921 | Corn Rhizosphere | RHLDIDFDVFNVLNAATPTAANFQSGPSFGYITGVLPARIARLGARFRF |
Ga0207646_105141281 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SAVDVFNVLNAATALSANFQSGPSFGYVTNVIPARIARLGARFRF |
Ga0207690_111301751 | 3300025932 | Corn Rhizosphere | NVLNAATPTAANFQSGPSFGYITGVLPARIARLGARFRF |
Ga0207686_101123972 | 3300025934 | Miscanthus Rhizosphere | IDVDVFNVLNAATPTAATFVTGPSFGYTTSVIPARIARLGLRYVF |
Ga0207712_119292322 | 3300025961 | Switchgrass Rhizosphere | VFNVLNAATPTAATFVTGPSFGYTSSVIPARIARLGVRFLF |
Ga0209761_11547702 | 3300026313 | Grasslands Soil | DFSLGSGRRIDVDFDIFNVLNAATPTSANFQSGPSFGYVTNVIPARIARLGVRFRF |
Ga0209687_12816172 | 3300026322 | Soil | DFSIGGGRRFEIDVDVFNVLNAAAPTGANFQSGPSFGFVTGVIPARIARLGARFRF |
Ga0137415_112968091 | 3300028536 | Vadose Zone Soil | DIDFDVFNALNAATPTGAQFQSGPSFGFVTGVIPARIARLGLRFRF |
Ga0307282_106247802 | 3300028784 | Soil | FNVLNAATPTAANFQSGPSFGFVSNVIPARIARLGVRFRF |
Ga0307312_109301682 | 3300028828 | Soil | LDVDVDIFNVLNAATPTAANFQSGPSFGFVSNVIPARIARLGVRFRF |
Ga0318538_100927642 | 3300031546 | Soil | MGRLSIDVDVFNVLNAATPTAATFVTGPSFGYTTSVIPARIARLGVRYVF |
Ga0306919_114686361 | 3300031879 | Soil | VDVFNVLNAATPTAATFVTGPSFGYTTSVIPARIARLGVRYVF |
Ga0306925_119720991 | 3300031890 | Soil | FGGDRRFDIDFDIFNVLNAATPTAANFQSGPSFGYVTGVIPARIARLGARFRF |
Ga0310900_109875842 | 3300031908 | Soil | ASKDLKLGTGRRLNIDVDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFLF |
Ga0306921_103445262 | 3300031912 | Soil | IDLDVFNLLNEATPLGANWSSGPTFGYVTDVIPGRIARIGFKFEF |
Ga0306921_105667231 | 3300031912 | Soil | AGRRLEIDLDVFNVFNAATPTGANFQSGPTFGYVTGVIPARIARLGARFRF |
Ga0318505_104350951 | 3300032060 | Soil | NVLNAATPTAATFVTGPSFGYTTSVIPARIARLGVRYVF |
Ga0307472_1014052342 | 3300032205 | Hardwood Forest Soil | IDVDVLNVLNAATPTAATFVTGPSFGYTTSVIPARIARLGLRYVF |
Ga0310914_118979102 | 3300033289 | Soil | KATIDLDVFNLLNEATPLGANWSSGPTFGYVTDVIPGRIARIGFKFEF |
Ga0364943_0426946_1_132 | 3300034354 | Sediment | VDVFNVLNAATPTAASFVTGPSFGFVSSVIPARIARLGLRFMF |
⦗Top⦘ |