NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105129

Metagenome / Metatranscriptome Family F105129

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105129
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 45 residues
Representative Sequence MTTKTRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRAS
Number of Associated Samples 91
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(44.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 27.78%    β-sheet: 0.00%    Coil/Unstructured: 72.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF10518TAT_signal 5.00
PF12796Ank_2 3.00
PF13520AA_permease_2 3.00
PF07969Amidohydro_3 2.00
PF12276DUF3617 2.00
PF13531SBP_bac_11 2.00
PF02585PIG-L 1.00
PF01297ZnuA 1.00
PF08811DUF1800 1.00
PF01557FAA_hydrolase 1.00
PF13432TPR_16 1.00
PF10370DUF2437 1.00
PF07681DoxX 1.00
PF13570PQQ_3 1.00
PF01253SUI1 1.00
PF08450SGL 1.00
PF11821ActD 1.00
PF12779WXXGXW 1.00
PF03992ABM 1.00
PF00589Phage_integrase 1.00
PF00664ABC_membrane 1.00
PF13671AAA_33 1.00
PF07995GSDH 1.00
PF12852Cupin_6 1.00
PF00004AAA 1.00
PF08592Anthrone_oxy 1.00
PF02738MoCoBD_1 1.00
PF07883Cupin_2 1.00
PF09537DUF2383 1.00
PF04014MazE_antitoxin 1.00
PF00474SSF 1.00
PF12867DinB_2 1.00
PF13453zf-TFIIB 1.00
PF11188DUF2975 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0023Translation initiation factor 1 (eIF-1/SUI1)Translation, ribosomal structure and biogenesis [J] 1.00
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 1.00
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.00
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.00
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.00
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.00
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.00
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.00 %
UnclassifiedrootN/A38.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_11700538All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300000956|JGI10216J12902_102674031All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300000956|JGI10216J12902_113308274All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300001199|J055_10337180All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004463|Ga0063356_100266275All Organisms → cellular organisms → Bacteria → Acidobacteria2092Open in IMG/M
3300004463|Ga0063356_105673276Not Available535Open in IMG/M
3300005178|Ga0066688_10275248Not Available1082Open in IMG/M
3300005330|Ga0070690_101454723Not Available552Open in IMG/M
3300005345|Ga0070692_11418015Not Available502Open in IMG/M
3300005347|Ga0070668_100482819All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300005353|Ga0070669_101334860Not Available621Open in IMG/M
3300005354|Ga0070675_100482371All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300005365|Ga0070688_101338340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300005366|Ga0070659_100422266All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300005455|Ga0070663_100080805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2388Open in IMG/M
3300005457|Ga0070662_100539868Not Available976Open in IMG/M
3300005466|Ga0070685_10926337All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005467|Ga0070706_100412771All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005539|Ga0068853_100640579All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300005544|Ga0070686_100246985Not Available1302Open in IMG/M
3300005548|Ga0070665_100964311All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005569|Ga0066705_10520402Not Available742Open in IMG/M
3300005577|Ga0068857_102300909All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005578|Ga0068854_101819304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium559Open in IMG/M
3300005713|Ga0066905_100891817All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005843|Ga0068860_100209806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1889Open in IMG/M
3300005844|Ga0068862_100920807All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005844|Ga0068862_101306502Not Available727Open in IMG/M
3300005844|Ga0068862_102371283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b542Open in IMG/M
3300006047|Ga0075024_100639610All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300006576|Ga0074047_10509831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300006844|Ga0075428_100208946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2110Open in IMG/M
3300006847|Ga0075431_101781925All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006852|Ga0075433_11768980Not Available531Open in IMG/M
3300006854|Ga0075425_100768147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1105Open in IMG/M
3300006871|Ga0075434_100638037All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300006903|Ga0075426_10490472All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006954|Ga0079219_10941316Not Available706Open in IMG/M
3300009053|Ga0105095_10087721All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300009094|Ga0111539_12337547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300009147|Ga0114129_12975593Not Available558Open in IMG/M
3300009156|Ga0111538_11183876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.966Open in IMG/M
3300009176|Ga0105242_12622349Not Available553Open in IMG/M
3300009239|Ga0103858_10020939All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1444Open in IMG/M
3300010047|Ga0126382_12110197Not Available539Open in IMG/M
3300010366|Ga0126379_10171571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2051Open in IMG/M
3300010398|Ga0126383_13467380All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300011432|Ga0137428_1114334Not Available775Open in IMG/M
3300011445|Ga0137427_10466732All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300012039|Ga0137421_1186822All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria610Open in IMG/M
3300012200|Ga0137382_10986336Not Available605Open in IMG/M
3300012685|Ga0137397_11175905Not Available554Open in IMG/M
3300012917|Ga0137395_11075307Not Available572Open in IMG/M
3300012976|Ga0134076_10631364Not Available503Open in IMG/M
3300012986|Ga0164304_11076675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300012989|Ga0164305_10510794All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300013308|Ga0157375_13786891Not Available502Open in IMG/M
3300014326|Ga0157380_12823015Not Available552Open in IMG/M
3300015241|Ga0137418_10365735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300015371|Ga0132258_10142311All Organisms → cellular organisms → Bacteria → Acidobacteria5740Open in IMG/M
3300015373|Ga0132257_102138559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300015374|Ga0132255_105581936Not Available532Open in IMG/M
3300018089|Ga0187774_10729369Not Available660Open in IMG/M
3300018476|Ga0190274_13922777Not Available504Open in IMG/M
3300018481|Ga0190271_11059575All Organisms → cellular organisms → Bacteria → Acidobacteria935Open in IMG/M
3300018481|Ga0190271_12518505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300019361|Ga0173482_10292755All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300019789|Ga0137408_1255396Not Available1085Open in IMG/M
3300022214|Ga0224505_10298647Not Available611Open in IMG/M
3300022309|Ga0224510_10571712Not Available667Open in IMG/M
3300025923|Ga0207681_10067561All Organisms → cellular organisms → Bacteria → Acidobacteria2479Open in IMG/M
3300025925|Ga0207650_11349282All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300025930|Ga0207701_11182876Not Available631Open in IMG/M
3300025934|Ga0207686_10758983All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300025934|Ga0207686_10940101Not Available699Open in IMG/M
3300025936|Ga0207670_10187847Not Available1561Open in IMG/M
3300025960|Ga0207651_11422499Not Available624Open in IMG/M
3300025981|Ga0207640_10210309All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300026116|Ga0207674_11999080Not Available545Open in IMG/M
3300026116|Ga0207674_12042256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026121|Ga0207683_11069502Not Available748Open in IMG/M
3300027748|Ga0209689_1334037Not Available581Open in IMG/M
3300027765|Ga0209073_10424366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300027909|Ga0209382_10085421All Organisms → cellular organisms → Bacteria3714Open in IMG/M
3300027910|Ga0209583_10255412All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300028380|Ga0268265_11320147All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028381|Ga0268264_10615291All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300028381|Ga0268264_11181456Not Available774Open in IMG/M
3300028536|Ga0137415_11404554Not Available520Open in IMG/M
3300031231|Ga0170824_113181935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300031720|Ga0307469_10875362All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300031720|Ga0307469_12266439All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031740|Ga0307468_102257533All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300031910|Ga0306923_11540533Not Available694Open in IMG/M
3300031912|Ga0306921_10678733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300032144|Ga0315910_11263110All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300032180|Ga0307471_102750056All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300032205|Ga0307472_102725784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300032955|Ga0335076_10122476Not Available2523Open in IMG/M
3300033412|Ga0310810_11470972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere5.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic1.00%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001199Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assemblyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1170053823300000953SoilMPTRKLSQCGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASE
JGI10216J12902_10267403113300000956SoilMATKNPLSDCGVSRRDMIRLGAGGLGFSLVGGLGPVPFVLNRASLEAAAEQ
JGI10216J12902_11330827413300000956SoilMATKNPLSECGVSRRDMIRLGAGGLGFSLVGGLGPVPFVLNRASLEAAAEQ
J055_1033718013300001199LoticMTIKSPLSGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAATSGR
Ga0063356_10026627513300004463Arabidopsis Thaliana RhizosphereVTPRTRLTDSGVSRRDLMRLGAGGLGFGLFGGIGPVPYALSQVSQ
Ga0063356_10567327613300004463Arabidopsis Thaliana RhizosphereMASRDRLSDSGVSRRDMMRLGAGGLGFGLFGGIGPVPYVLSQASQ
Ga0066688_1027524823300005178SoilMPTKHLLSGSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVF
Ga0070690_10145472323300005330Switchgrass RhizosphereVTTKTGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPYVLNQ
Ga0070692_1141801513300005345Corn, Switchgrass And Miscanthus RhizosphereMPTKHPLSDSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVFSQASLQAA
Ga0070668_10048281923300005347Switchgrass RhizosphereVTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGLGPVPYVL
Ga0070669_10133486013300005353Switchgrass RhizosphereMPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEVA
Ga0070675_10048237113300005354Miscanthus RhizosphereVTTKDGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPFVLNQASLDAATNQSGRI
Ga0070688_10133834023300005365Switchgrass RhizosphereMPSRGPLSGCGVSRRDLMRLGAGGFGFGLFGGIGPVPFVLGQASRAAA
Ga0070659_10042226623300005366Corn RhizosphereMPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEV
Ga0070663_10008080543300005455Corn RhizosphereMTTKDGLSDASGVSRRDLMRLGAGGIGFGLFGGLGPVPYVLNQASLAAATNT
Ga0070662_10053986813300005457Corn RhizosphereMSVHDKLAASGVSRRDMLRIGAGGVGFSLFGGIGPVPAVFG
Ga0070685_1092633723300005466Switchgrass RhizosphereVTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVL
Ga0070706_10041277113300005467Corn, Switchgrass And Miscanthus RhizosphereMPTKHLVGGSGVTRRDMIRMGAGGLGFGLFGGLGPVPRVF
Ga0068853_10064057913300005539Corn RhizosphereMPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVRHVFSRASQVA
Ga0070686_10024698513300005544Switchgrass RhizosphereVRGACEALMSVHDKLAASGVSRRDMLRIGAGGVGFSLFGGIGPV
Ga0070665_10096431113300005548Switchgrass RhizosphereVTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGLGPVPYV
Ga0066705_1052040223300005569SoilMTTKTRLSGCGVSRRDMLRIGAGGLGFGLFGGIGPVPYLFSRASEVAAQTASDK
Ga0068857_10230090923300005577Corn RhizosphereMTTRNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGSVPPVLSQASSSVAAK
Ga0068854_10181930413300005578Corn RhizosphereMTIPTKLCDCGISRRDLIRLGAGGLGFGLFGGLGPVPYVFSRASEVAAATD
Ga0066905_10089181723300005713Tropical Forest SoilMSTTTWSGCGVSRRDMIRLGAGGLGFGLFGGIGPVPYVFRTASEV
Ga0068860_10020980613300005843Switchgrass RhizosphereMTAKTRLSDSGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSR
Ga0068862_10092080723300005844Switchgrass RhizosphereVTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVLAQASR
Ga0068862_10130650213300005844Switchgrass RhizosphereVTTRNGLSDSGVSRRDMMRLGAGGIGFGLFGGLGPVPYVLNQASLAA
Ga0068862_10237128323300005844Switchgrass RhizosphereMPIKSPLCGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAST
Ga0075024_10063961013300006047WatershedsMTTNCRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASE
Ga0074047_1050983113300006576SoilMTTKTRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRAS
Ga0075428_10020894613300006844Populus RhizosphereMPTKDLLSGSGVTRRDMIRIGAGGLGFGLLGGFGPVPRVFSQASLQAAA
Ga0075431_10178192523300006847Populus RhizosphereMPSKHLLSDSGVTRRDMIRIGAGGLGFGLLGGFGPVPRVFSQA
Ga0075433_1176898013300006852Populus RhizosphereMPGRNRSDDSGVSRRDMMRLGAGGLGFGLFGGVGPVPFVFSQASR
Ga0075425_10076814713300006854Populus RhizosphereMPKHDPLSASGLSRRDLLRLGAGGIGLGLAGGLGTVPT
Ga0075434_10063803723300006871Populus RhizosphereMPSKHLLSDSGVTRRDMIRMGAGGLGLGLFGGFGPVPRVFSQASLQAAAH
Ga0075426_1049047213300006903Populus RhizosphereMPTKHLVGGSGVTRRDMIRLGAGGLGFGLFGGLGPVPRVFSEA
Ga0079219_1094131623300006954Agricultural SoilMTTTDGLSDASGVSRRDLMRLGVGGIGFGLFGGLGPVPYVLNQA
Ga0105095_1008772133300009053Freshwater SedimentMTIKSPLRGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAA
Ga0111539_1233754723300009094Populus RhizosphereMSTKNPLIDSGISRRDMIRIGAGGMGFNLLGGIGPVP
Ga0114129_1297559323300009147Populus RhizosphereMATKRRLTDCGVSRRDIIRIGASGLGFGLFGGIGP
Ga0111538_1118387633300009156Populus RhizosphereMARSRLSDGSGVSRRELIRLGAGGVGFGLFGGLGPVPYVLAQAS
Ga0105242_1262234923300009176Miscanthus RhizosphereMTTRSRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYV
Ga0103858_1002093913300009239River WaterMTTHKELCDCGVSRRDMMKIGAGGLGFALTGGIGS
Ga0126382_1211019713300010047Tropical Forest SoilMSLKSPLDGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQAS
Ga0126379_1017157153300010366Tropical Forest SoilMTTKNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGQVPPVLSQASY
Ga0126383_1346738023300010398Tropical Forest SoilMSIHHKLSDCGVSRRDMIRIGAGGLGFGLFGGLGPVPYVFGKASAAAATTSSGKI
Ga0137428_111433423300011432SoilMTIKNPLSSCGVSRRDLLRIGASGLGLGLYGGLGPVPYVL
Ga0137427_1046673213300011445SoilMNITSRLRDSGVSRREMMRIGAGGLGFSLFGGIGPVPHVLSQASWAAAA
Ga0137421_118682213300012039SoilMTKWDETGVSRRDLMRLGAGGLGLGLLGGVGSVPSVLAQAARSVSA
Ga0137382_1098633613300012200Vadose Zone SoilMPTKHLLSGSGGTRRDMIRMGAGGLGFSLFGGLGPVPRVFNQSS
Ga0137397_1117590513300012685Vadose Zone SoilMPTKHLLSGSGVTRRDMIRMGAGGLGFGLFGGLGPVPRVF
Ga0137395_1107530713300012917Vadose Zone SoilMTIPKKLCDCGISRRDLIRLGAGGLGFGLFGGLGPVPYLFSKAS
Ga0134076_1063136413300012976Grasslands SoilMSMHKTLAHCGVSRRDLMRLGAGGLGFGLFGGFGPVPYVFSKASE
Ga0164304_1107667523300012986SoilMPTKQLLGGSGVTRRDMIRLGAGGLGFGLIGGLGPV
Ga0164305_1051079423300012989SoilMSAHKKLTDCGISRRDLMRLGTGGLGFGLFGGIGPVPYVFSKAS
Ga0157375_1378689113300013308Miscanthus RhizosphereMTTKSRLSDCGVSRRDMIRIGAGGLGFGLFGGFGPVPAVLAQASRAASAP
Ga0157380_1282301513300014326Switchgrass RhizosphereMTAKNLLTGTNISRRDMLRFGAGGVGLGLFGGIGPVPPVLAQASRS
Ga0137418_1036573513300015241Vadose Zone SoilMPTKHLLSGSGVTRRDMIRMGAGGLGFSLFGGFGPVPRVFNQASL
Ga0132258_1014231113300015371Arabidopsis RhizosphereMSSGNRLQRDSGVSRRDMMRIGAGGLGFGLFGGIGPVPYL
Ga0132257_10213855923300015373Arabidopsis RhizosphereMSTHDKLSDCGVSRRDMILIGAGGLGFGLFGGIGPVPSVFGQASAAAAAAN
Ga0132255_10558193613300015374Arabidopsis RhizosphereMATKNPWNEINVSRRDMLRIGAGGIGLGLFGGIGPVPPVLSQASRS
Ga0187774_1072936913300018089Tropical PeatlandMITKKVLADCGVSRRDMLRIGAGGLGFGLFGGLGPVPYIFSKATEAA
Ga0190274_1392277713300018476SoilMSSKSRLSDCGVSRRDMMRIGAGGLGFGLFGGIGPVPYVLAQASQAAATNTSGK
Ga0190271_1105957523300018481SoilVTTKNGLSDSGVSRRDMMRLGAGGLGFGLFGGLGPVPYVLNQASLAA
Ga0190271_1251850523300018481SoilMTTKNPLSGCGVSRRDMLRIDASGLGLGLYGGLGPVP
Ga0173482_1029275513300019361SoilMPIKHPLSGSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVFGQAS
Ga0137408_125539623300019789Vadose Zone SoilMTNKNPLTGTGVSRRDMLRLGAGGIGLGLFGGVGPVPP
Ga0224505_1029864723300022214SedimentMKNRLSECGVSRRDMIRIGAGGLGFGLFGGLGPVPFVFSRATL
Ga0224510_1057171223300022309SedimentMKNRLSECGVSRRDMIRIGAGGLGFGLFGGLGPVPFVFSRATLEA
Ga0207681_1006756113300025923Switchgrass RhizosphereMTTSNGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPY
Ga0207650_1134928213300025925Switchgrass RhizosphereMASKSRLTDCGVSRRDMIRIGAGGLGFGLLGGIGPVPFVLNRATLQAAAEESG
Ga0207701_1118287623300025930Corn, Switchgrass And Miscanthus RhizosphereMASKSRLTDCGVSRRDMIRIGAGGLGFGLLGGIGPVPFVLNRATLQAAAEE
Ga0207686_1075898313300025934Miscanthus RhizosphereMPTKHLLSGSGVTRRDMIRLGAGGLGFGLFGGFGPVPRV
Ga0207686_1094010123300025934Miscanthus RhizosphereMTTKSRLSASGVSRRDMLRIGASGLGFGLFGGIGPVPY
Ga0207670_1018784733300025936Switchgrass RhizosphereVTTKTGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPV
Ga0207651_1142249913300025960Switchgrass RhizosphereMPTRKLSQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEVAAAAESGKI
Ga0207640_1021030913300025981Corn RhizosphereMPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASQVAAAAESGK
Ga0207674_1199908013300026116Corn RhizosphereMATKHLVNASGVTRRDMIRLGAGGLGFGLFGGFGPVPEVFSEASLQAAAHDSGRILVVF
Ga0207674_1204225623300026116Corn RhizosphereMTTRNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGSVPPVLSQASSSVAAKQ
Ga0207683_1106950233300026121Miscanthus RhizosphereMTTNDRLGETGLSRRDMLRLGAGGLGLGLFGGIGSVPPVLAQASRSVATNGAA
Ga0209689_133403713300027748SoilMPTKHLLSGSGVTRRDMIRIGAGGIGFGLFGGIGPVPRL
Ga0209073_1042436613300027765Agricultural SoilMTTKNPLTETSVSRRDMLRLGAGGLGLGLFGGIGHVPPVFSQASYSVAAKQ
Ga0209382_1008542153300027909Populus RhizosphereMPTNSRLTGCGVSRRDMIRIGAGGLGFGLFGGLGPVPYVFGKASEVAAAANSGKIL
Ga0209583_1025541213300027910WatershedsMTTKTRLSGCGVSRRDMLRIGAGGLGFGLFGGIGPVPYLFSRASEVAAQTA
Ga0268265_1132014713300028380Switchgrass RhizosphereVTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVLAQ
Ga0268264_1061529113300028381Switchgrass RhizosphereVTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGIGPVP
Ga0268264_1118145623300028381Switchgrass RhizosphereMTTRSRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASEVVAEAASNKILV
Ga0137415_1140455413300028536Vadose Zone SoilMTIPKKLADCGISRRDLIRLGTGGLGFSLVGGIGPVP
Ga0170824_11318193513300031231Forest SoilMTTKTRLSDCGVSRRDMLRIGASGLGFGLFGGIGPVPYVFSRASE
Ga0307469_1087536223300031720Hardwood Forest SoilMTTMRRLSKCGVSRRDMMRLGAGGLGFGLFGGLGPVPYVLSQASLAAATRSGRI
Ga0307469_1226643913300031720Hardwood Forest SoilMTTRTRLSACGVSRRDMLRIGASGLGFGLFGGIGPVPYVFSRASEVVAQ
Ga0307468_10225753313300031740Hardwood Forest SoilMTIRNPLCGCGVSRRDMLRIGASGLGLGLYGGLGPVP
Ga0306923_1154053313300031910SoilMTTKNPLTETSVSRRDMLRLGAGGLGLGLFGGIGYVPPVFSQASYSIAAKQS
Ga0306921_1067873323300031912SoilMSTQKLNESGISRRDMIRIGTGGLGFGLFGGIGPVPYL
Ga0315910_1126311023300032144SoilMTKRLSDCGVSRRDMIRIGAGGVGFGLFGGLGPVPFVFSQASLE
Ga0307471_10275005623300032180Hardwood Forest SoilMPTRKLCRCDVSRRDMLRIGAGGLGFGLFGGIGPVPRVFSRASEVAAA
Ga0307472_10272578413300032205Hardwood Forest SoilMSTHDKLSDCGVSRRDMIRIGAGGLGFGLFGGIGPVPSVFGQASAAAAAANNSGKILV
Ga0335076_1012247613300032955SoilMASNDPFRNCDISRRDVIRIGSAGLGFGLFGGIGPVPYIFSRASEVAA
Ga0310810_1147097223300033412SoilMPTKQLLGGSGVTRRDMIRLGAGGLGFGLIGGLGPVPRVFSEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.