NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105268

Metagenome / Metatranscriptome Family F105268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105268
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 51 residues
Representative Sequence MIRRITGIVLGVLAFLLVYWLTGLGTPSEPNWALALLVGLVVALIWPWI
Number of Associated Samples 92
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.00 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 94.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.000 % of family members)
Environment Ontology (ENVO) Unclassified
(38.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.25%    β-sheet: 0.00%    Coil/Unstructured: 46.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane regiond2vv5a32vv50.79315
d.135.1.1: The spindle assembly checkpoint protein mad2d2qyfa_2qyf0.71248
c.72.1.0: automated matchesd4b8ra_4b8r0.71239
f.42.1.1: Mitochondrial carrierd1okca_1okc0.7113
f.57.1.1: MgtE membrane domain-liked2zy9a32zy90.70134

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF04542Sigma70_r2 27.00
PF04545Sigma70_r4 10.00
PF01571GCV_T 8.00
PF08281Sigma70_r4_2 7.00
PF05014Nuc_deoxyrib_tr 4.00
PF09966DUF2200 4.00
PF03706LPG_synthase_TM 3.00
PF02909TetR_C_1 2.00
PF00175NAD_binding_1 2.00
PF00970FAD_binding_6 2.00
PF01807zf-CHC2 2.00
PF13662Toprim_4 1.00
PF08031BBE 1.00
PF06897DUF1269 1.00
PF08002DUF1697 1.00
PF12740Chlorophyllase2 1.00
PF13480Acetyltransf_6 1.00
PF06863DUF1254 1.00
PF03928HbpS-like 1.00
PF00126HTH_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 27.00
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 27.00
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 27.00
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 27.00
COG3613Nucleoside 2-deoxyribosyltransferaseNucleotide transport and metabolism [F] 4.00
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 3.00
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 2.00
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 2.00
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.00
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 1.00
COG4803Uncharacterized membrane proteinFunction unknown [S] 1.00
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.00 %
UnclassifiedrootN/A18.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10862273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300000955|JGI1027J12803_105480895All Organisms → cellular organisms → Bacteria → Terrabacteria group1195Open in IMG/M
3300001213|JGIcombinedJ13530_102957691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium724Open in IMG/M
3300002568|C688J35102_118357149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300004013|Ga0055465_10060473All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300004114|Ga0062593_103235635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300005093|Ga0062594_102341179All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005162|Ga0066814_10086921Not Available569Open in IMG/M
3300005168|Ga0066809_10166981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium579Open in IMG/M
3300005334|Ga0068869_101790207Not Available549Open in IMG/M
3300005343|Ga0070687_100890315All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300005457|Ga0070662_101401935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium602Open in IMG/M
3300005518|Ga0070699_101495431All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005535|Ga0070684_100453807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1185Open in IMG/M
3300005539|Ga0068853_100841183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium880Open in IMG/M
3300005578|Ga0068854_101118126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14703Open in IMG/M
3300005617|Ga0068859_101145566All Organisms → cellular organisms → Bacteria → Proteobacteria856Open in IMG/M
3300006358|Ga0068871_101669048All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006358|Ga0068871_101866540All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006581|Ga0074048_12550018Not Available657Open in IMG/M
3300006806|Ga0079220_11178507All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300006881|Ga0068865_101027554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium723Open in IMG/M
3300009098|Ga0105245_11514973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi722Open in IMG/M
3300009156|Ga0111538_13092862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300010154|Ga0127503_10128037Not Available501Open in IMG/M
3300010399|Ga0134127_10441849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141298Open in IMG/M
3300010400|Ga0134122_10697796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium953Open in IMG/M
3300011107|Ga0151490_1550215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300011119|Ga0105246_11160185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi709Open in IMG/M
3300012208|Ga0137376_11088939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium683Open in IMG/M
3300012505|Ga0157339_1053084Not Available542Open in IMG/M
3300012882|Ga0157304_1103912Not Available522Open in IMG/M
3300012897|Ga0157285_10220347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi607Open in IMG/M
3300012901|Ga0157288_10127717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium730Open in IMG/M
3300012914|Ga0157297_10520477Not Available504Open in IMG/M
3300012955|Ga0164298_10283375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1017Open in IMG/M
3300012955|Ga0164298_10448303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium848Open in IMG/M
3300012955|Ga0164298_10825351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi666Open in IMG/M
3300012958|Ga0164299_11389533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300012961|Ga0164302_10580170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium809Open in IMG/M
3300012971|Ga0126369_10478848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1299Open in IMG/M
3300012985|Ga0164308_10024863All Organisms → cellular organisms → Bacteria3561Open in IMG/M
3300013308|Ga0157375_13125262All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300014266|Ga0075359_1136455Not Available538Open in IMG/M
3300014325|Ga0163163_10026527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales5540Open in IMG/M
3300014326|Ga0157380_11600505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium707Open in IMG/M
3300015077|Ga0173483_10245423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium849Open in IMG/M
3300015200|Ga0173480_10198855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1061Open in IMG/M
3300015200|Ga0173480_10872056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300015371|Ga0132258_11757275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1563Open in IMG/M
3300015372|Ga0132256_101104319All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300015373|Ga0132257_104377205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300015374|Ga0132255_101301888All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300015374|Ga0132255_105643211Not Available529Open in IMG/M
3300015374|Ga0132255_105800603Not Available522Open in IMG/M
3300016270|Ga0182036_11698395Not Available533Open in IMG/M
3300016422|Ga0182039_11098972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium716Open in IMG/M
3300017792|Ga0163161_11441054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M
3300017959|Ga0187779_10183561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1303Open in IMG/M
3300017965|Ga0190266_10197952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales957Open in IMG/M
3300018084|Ga0184629_10404750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi717Open in IMG/M
3300018476|Ga0190274_11189703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium846Open in IMG/M
3300019361|Ga0173482_10446835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium613Open in IMG/M
3300020005|Ga0193697_1065091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium898Open in IMG/M
3300020020|Ga0193738_1132368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium686Open in IMG/M
3300022883|Ga0247786_1053329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium822Open in IMG/M
3300022886|Ga0247746_1134398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium623Open in IMG/M
3300022899|Ga0247795_1083944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi558Open in IMG/M
3300022915|Ga0247790_10144510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi610Open in IMG/M
3300025792|Ga0210143_1044200Not Available786Open in IMG/M
3300025931|Ga0207644_10886409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300025933|Ga0207706_11244845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300025934|Ga0207686_10829650All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300025937|Ga0207669_11499634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium575Open in IMG/M
3300025938|Ga0207704_11958713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300025941|Ga0207711_10154573All Organisms → cellular organisms → Bacteria2072Open in IMG/M
3300025945|Ga0207679_10567265Not Available1020Open in IMG/M
3300025947|Ga0210067_1019441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium885Open in IMG/M
3300025972|Ga0207668_10403185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1157Open in IMG/M
3300025986|Ga0207658_12197569Not Available501Open in IMG/M
3300026095|Ga0207676_10892557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium871Open in IMG/M
3300026118|Ga0207675_100769114All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300026118|Ga0207675_101276677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14755Open in IMG/M
3300027907|Ga0207428_10374623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1045Open in IMG/M
3300028754|Ga0307297_10133056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi839Open in IMG/M
3300028802|Ga0307503_10777171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M
3300028814|Ga0307302_10466479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi626Open in IMG/M
3300029980|Ga0302298_10004348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3442Open in IMG/M
3300030491|Ga0302211_10008820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2827Open in IMG/M
3300031713|Ga0318496_10292493Not Available899Open in IMG/M
3300031720|Ga0307469_11030716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi770Open in IMG/M
3300031740|Ga0307468_100994601Not Available737Open in IMG/M
3300031765|Ga0318554_10659269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium588Open in IMG/M
3300031854|Ga0310904_11043802Not Available584Open in IMG/M
3300031879|Ga0306919_11466639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300032039|Ga0318559_10541798Not Available543Open in IMG/M
3300032089|Ga0318525_10032141All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300033550|Ga0247829_10545263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi962Open in IMG/M
3300033551|Ga0247830_11272857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi588Open in IMG/M
3300033551|Ga0247830_11391356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium561Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.00%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025947Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1086227313300000891SoilMIRRITGIILGVLAFLLVYWITGLGTPSQPNWALAALIGLVIALIWPW
JGI1027J12803_10548089513300000955SoilMIRRITGIILGVLAFLIVYWLSGLGTPSNPNLALAILVGLVVALIW
JGIcombinedJ13530_10295769113300001213WetlandMIRRITGIILGVVAFLIVFWLTGGLATPATPNWALAILVGLVVALIWPWI
C688J35102_11835714923300002568SoilMIRRITGIVIGVLAFLLVYWITGLGNPSNPNLALAALIGLVVALIWPWLFGI
Ga0055465_1006047313300004013Natural And Restored WetlandsMIRRITGIILGVLAFLLVYWLSGGMATPSTPNWALAILVGLVVALIW
Ga0062593_10323563513300004114SoilMIRRITGIILGVLAFLLVYWATGLGTPSQPNLALAALVGLVVALIWPWIMGLIVVRR
Ga0062594_10234117923300005093SoilMIRRITGIVLGVLAFLLVYWITGLGTPSQPNWALAALVGLVIALIWPWLFGIYAVRRVRQNRQN
Ga0066814_1008692123300005162SoilMIRRITGIVLGVVAFFIVYWLTGGLATPSTPNWALAILVGLVVALIWPWI
Ga0066809_1016698123300005168SoilMIRRITGIIIGVLAFLLVYWLTGLGNPSNPNLALAALIGLVVALIWPWLFGLYMV
Ga0068869_10179020723300005334Miscanthus RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWIFGLIMVRRVRQNRQAE
Ga0070687_10089031523300005343Switchgrass RhizosphereMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALAILVGLVVALIWPWIFGLIV
Ga0070662_10140193513300005457Corn RhizosphereMIRRITGIIIGVLAFFLVYWLTGLGTPSNPNWALAALVGLVVALLWP
Ga0070699_10149543123300005518Corn, Switchgrass And Miscanthus RhizosphereMIRRITGIILGVVAFLIVYWLTGGLATPSNPNWALAILVGLVVALIWPWIMGLIIVRRAR
Ga0070684_10045380713300005535Corn RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWIFGLIMVR
Ga0068853_10084118323300005539Corn RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALI
Ga0068854_10111812613300005578Corn RhizosphereMIRRITGIILGVVAFLIVFWLTGGFATPATPNWALAIL
Ga0068859_10114556613300005617Switchgrass RhizosphereMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLLLVRRVRQRRQDEIDR
Ga0068871_10166904823300006358Miscanthus RhizosphereMIRRITGIILGVVAFLIVYWLTGGLATPSNPNWALAILVGLVVALIWPWIMGLIIV
Ga0068871_10186654023300006358Miscanthus RhizosphereMIRRITGIVLGVLAFLLVYWITGLGTPSQPNWALAALVGLVIALIWPWLFGIYAVRRV
Ga0074048_1255001823300006581SoilMIRRITGIILGVLVFFLVYWITGLGTPSNPNWALAALIGLVVALI*
Ga0079220_1117850723300006806Agricultural SoilMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALAILVGLVVALIWPWIFGLIVVRR
Ga0068865_10102755413300006881Miscanthus RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWIFGLIMVRRV
Ga0105245_1151497313300009098Miscanthus RhizosphereMIRRITGIIIGVLAFFLVYWLTGLGTPSNPNWALAALVGLVVALIWPWLFGLFMVRRVRQIDAGDA*
Ga0111538_1309286213300009156Populus RhizosphereMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLIVAIL
Ga0127503_1012803723300010154SoilVLAFLLVYWVTGLGTPSEPNWALAILVGLVIALIWPWLFGLYAVRRVRQNRQNEIDQE
Ga0134127_1044184913300010399Terrestrial SoilMEGSHMIRRITGIILGVVAFLIVFWLTGGFATPATPNWALAILVGLVV
Ga0134122_1069779623300010400Terrestrial SoilMIRRITGIVLGVLAFLLVYWLTSVTSTPSSPNWALAILVGLVVALIWPWLFGLY
Ga0151490_155021513300011107SoilMIRRITGIVLGVLAFLLVYWLTSATSTPSSPNWALSLLV
Ga0105246_1116018513300011119Miscanthus RhizosphereMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLLLVRRVRQRRQDE
Ga0137376_1108893923300012208Vadose Zone SoilMEGLVTMIRRITGIVLGVLAFFLVYWATGLGTPSNPNWALSILVGLVVALLW
Ga0157339_105308413300012505Arabidopsis RhizosphereMIRRITGIVLGVVAFLIVYWLTGGTATPSTPNWALAILVGLVVALI
Ga0157304_110391223300012882SoilMIRRITGIIIGVLAFLLVYWLSGGFATPSTPNWALSILVGLVVALIWPWLFGLM
Ga0157285_1022034713300012897SoilMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLVVALL
Ga0157288_1012771713300012901SoilMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWIFG
Ga0157297_1052047723300012914SoilMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLVVALLWPWLFGLYMVRRVK
Ga0164298_1028337533300012955SoilMIRRITGIVLGVLAFLLVYWLSGLGTPSNPNLALALLVGLVVALVWPWLFGLYMVRRVRQNRQ
Ga0164298_1044830313300012955SoilMIRRITGIIIGVLAFFLVYWLTGLGTPSNPNWALAALVGLVVALLWPWLFGLMMVRR
Ga0164298_1082535123300012955SoilMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLVVAL
Ga0164299_1138953323300012958SoilMIRRITGIVLGVLAFLLVYWLTSATSTPSSPNWALS
Ga0164302_1058017013300012961SoilMIRRITGIILGVLAFLLVYWLSGLGTPSNPNLALALLVGLVV
Ga0126369_1047884833300012971Tropical Forest SoilMIRRITGIILGVLAFFLVYWITGLGTPSQPNWALAALVGLVIALIWPWVFGLIAVRRVRQ
Ga0164308_1002486353300012985SoilMIRRITGIIIGVLAFFLVYWLTGLGTPSNPNWALAALVGLVVALLWPWLFGL
Ga0157375_1312526213300013308Miscanthus RhizosphereMIRRITGIILGVVAFLIVYWLTGGVATPATPNWALAILVGLV
Ga0075359_113645513300014266Natural And Restored WetlandsMIRRITGIILGVVAFLIVYWLSGGLATPATPNWALAILVGLVVALIWPWVM
Ga0163163_1002652713300014325Switchgrass RhizosphereMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALAILVGL
Ga0157380_1160050523300014326Switchgrass RhizosphereMIRRITGIIIGVIAFFLVYWLTGLGTPSQPNWALAALIGL
Ga0173483_1024542323300015077SoilMIRRITGIILGVLAFLLVYWFTGLGTPSQPNWALAALIGLVVALIWPWLFGLYAVRR
Ga0173480_1019885513300015200SoilMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLVVALIWPWLFGLMMVRRVRQNRQA
Ga0173480_1087205613300015200SoilMIRRITGIILGVLVFFLVYWITGLGTPSNPNWALAALIGLVVALLWPWV
Ga0132258_1175727513300015371Arabidopsis RhizosphereMIRRITGIILGVVAFLIVYWLTGGLATPSNPNWALAILVGLVVALIWPWIMGLIIVRRA
Ga0132256_10110431913300015372Arabidopsis RhizosphereMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALAILVG
Ga0132257_10437720513300015373Arabidopsis RhizosphereMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLLL
Ga0132255_10130188833300015374Arabidopsis RhizosphereMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALAILVGLVVALIWPWIM
Ga0132255_10564321113300015374Arabidopsis RhizosphereMIRRITGIILGVVAFLIVFWLPGGLATPATPNWALALLVGLVVALIWPWIMGLIIVRRA
Ga0132255_10580060313300015374Arabidopsis RhizosphereMIRRITGIVLGVLAFLLVYWLTGLGTPSNPNLALAALVGLVVALLWPWLFGLY
Ga0182036_1169839523300016270SoilMIRRITGIVLGVGAFLIVYWLTGGFATPATPNWALAILVGLVVALIWPWIMGILLV
Ga0182039_1109897213300016422SoilMIRRIVGIVLGVVAFFIVYWITGLGTPSQPNWALAALIGLVIALIWPWV
Ga0163161_1144105413300017792Switchgrass RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWIFGLIMVRRVRQNRQAEI
Ga0187779_1018356123300017959Tropical PeatlandMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALSILVGLVVALIWPWIMGLLLVRR
Ga0190266_1019795213300017965SoilMIRRITGIILGVLAFFLVYWLSGGMATPSTPNWALAILVGLVVALI
Ga0184629_1040475023300018084Groundwater SedimentMIRRITGIILGVVAFLIVYWVSGLGTPSTPNLALAILVGLVVALIWP
Ga0190274_1118970313300018476SoilMIRRITGIIIGVIAFLLVYWITGLGTPSNPNLALAALIGLVVALIWPWLFGLFMVRRVRQNR
Ga0173482_1044683513300019361SoilMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWVFGLVMVRRVRQNRQ
Ga0193697_106509113300020005SoilMIRRITGIIIGVLAFFLVYWLTGLGTPSNPNWALAALVGLVVALIWPWLFGLFMVRRVRQNR
Ga0193738_113236823300020020SoilMIRRITGIALGVLAFLLVYALSGGMATPSNPNWALSLL
Ga0247786_105332913300022883SoilMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWVFGLI
Ga0247746_113439823300022886SoilMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLV
Ga0247795_108394423300022899SoilMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLLLVRR
Ga0247790_1014451013300022915SoilMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLL
Ga0210143_104420013300025792Natural And Restored WetlandsMIRRITGIILGVVAFLIVYWLTGGLATPATPNWALAILVGLVVALIWPW
Ga0207644_1088640913300025931Switchgrass RhizosphereMIRRITGIILGVLAFLLVYWLSGLGTPSNPNLALALLV
Ga0207706_1124484523300025933Corn RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVALIWPWI
Ga0207686_1082965023300025934Miscanthus RhizosphereMIRRITGIILGVVAFLIVYWLTGGVATPATPNWALAILVGLVVALIWPWVMGLIVVRR
Ga0207669_1149963413300025937Miscanthus RhizosphereMIRRITGIVLGVVAFLLVYWATGLGTPSNPNLALALLVGLVVALIWPWL
Ga0207704_1195871313300025938Miscanthus RhizosphereMIRRITGIVLGVVAFLLVYWATGLGTPSNPNLALALL
Ga0207711_1015457313300025941Switchgrass RhizosphereIVLGVLAFLLVYWLSGLGTPSNPNLALALLVGLVVALLWPWLGLTK
Ga0207679_1056726543300025945Corn RhizosphereMIRRITGIVLGVVAFFIVYWLTGGFATPATPNWALA
Ga0210067_101944123300025947Natural And Restored WetlandsMIRRITGIILGVLAFVLVYWITGLGTPSEPNWALAALIGLVVALIWPWIFGLYAVRRVRQKRQND
Ga0207668_1040318533300025972Switchgrass RhizosphereMIRRITGIVLGVLAFLLVYWLTGLGTPSEPNWALALLVGLVVALIWPWI
Ga0207658_1219756913300025986Switchgrass RhizosphereMIRRITGIVLGVLAFLLVYWLTSVTSTPSSPNWALAILVGLVVALIWPWLFGLYMVR
Ga0207676_1089255723300026095Switchgrass RhizosphereMIRRITGIILGVLVFFVVYWITGLGTPSNPNWALAALIGLVVA
Ga0207675_10076911413300026118Switchgrass RhizosphereMIRRITGIVLGVLAFLLVYWLTGLGTPSNPNLALALLVGLVVALLWPWVFGLFMVRRVRQNRQNENFVSLPIWTPTR
Ga0207675_10127667713300026118Switchgrass RhizosphereMIRRITGIILGVVAFLIVFWLTGGFATPATPNWALAILVGLVVALIWPWVMGLIVVR
Ga0207428_1037462313300027907Populus RhizosphereMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSL
Ga0307297_1013305623300028754SoilMEDSRMIRRITGIIIGVLVFFLVYWITGLGTPSNPNWALAALIGLVVAILWPWVFGLIMVRRVRANR
Ga0307503_1077717113300028802SoilMIRRITGIVLGVLAFLLVYWLSGLGTPSNPNLALALLVGLVVALLW
Ga0307302_1046647923300028814SoilMIRRITGIIIGVLVFFLVYWITGVGTPSNPNWALAALIGLV
Ga0302298_1000434843300029980FenMIRRITGIILGVVAFLIVYWLTGGTATPATPNWALAILVG
Ga0302211_1000882043300030491FenMIRRITGIILGVVAFLIVYWLTGGTATPATPNWALAILVGLVVA
Ga0318496_1029249313300031713SoilMIRRITGIVLGVGAFLIVYWLTGGFATPATPNWALAILVGLVVALIWPW
Ga0307469_1103071623300031720Hardwood Forest SoilMIRRISGIILGVLAFLLVYWFTGLGTPSQPNWALAALIGLVVALIWPW
Ga0307468_10099460123300031740Hardwood Forest SoilMIRRITGIILGVVAFLIVYWLTGGLATPATPNWALAILVGLLVALIWPWVMGLIVVRRAR
Ga0318554_1065926923300031765SoilMIRRIVGIVLGVVAFFIVYWITGLGTPSQPNWALAALIGLVIALIWPWVFGIWAVRRVRQRRQD
Ga0310904_1104380223300031854SoilMIRRITGIILGVVAFLLVYWLTGGFATPATPNWALAILVG
Ga0306919_1146663923300031879SoilMIRRIVGIVLGVVAFFIVYWITGLGTPSQPNWALAALIGLVIALIWPWVFGIWAVRRV
Ga0318559_1054179813300032039SoilMIRRITGIVLGVGAFLIVYWLTGGFATPATPNWALAILVGLVVALIWPWIMGILL
Ga0318525_1003214113300032089SoilMIRRIVGIVLGVVAFFIVYWITGLGTPSQPNWALAALIGLVIALIWPW
Ga0247829_1054526323300033550SoilMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLL
Ga0247830_1127285723300033551SoilMIRRITGIVLGVLAFLLVYWLTGLGTPSQPNLALAALIGLVVALL
Ga0247830_1139135613300033551SoilMIRRISGIVLGVIAFLLVYWLSGLGTPSNPNLALSLLVGLVVALISPWIIGLLLVRRVRQRRQDEI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.