NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105519

Metagenome Family F105519

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105519
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 43 residues
Representative Sequence KEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 98.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.21%    β-sheet: 0.00%    Coil/Unstructured: 64.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF07883Cupin_2 25.00
PF03401TctC 1.00
PF00596Aldolase_II 1.00
PF12860PAS_7 1.00
PF11250FAF 1.00
PF00982Glyco_transf_20 1.00
PF03006HlyIII 1.00
PF03707MHYT 1.00
PF03450CO_deh_flav_C 1.00
PF00578AhpC-TSA 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 1.00
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 1.00
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.00
COG3300MHYT domain, NO-binding membrane sensorSignal transduction mechanisms [T] 1.00
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.00 %
UnclassifiedrootN/A49.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig114426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300000956|JGI10216J12902_100154926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1859Open in IMG/M
3300000956|JGI10216J12902_102280600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria709Open in IMG/M
3300005165|Ga0066869_10038752Not Available799Open in IMG/M
3300005331|Ga0070670_100334534Not Available1328Open in IMG/M
3300005336|Ga0070680_101724935Not Available543Open in IMG/M
3300005457|Ga0070662_101427414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300005467|Ga0070706_100792094Not Available878Open in IMG/M
3300005547|Ga0070693_101003379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300005548|Ga0070665_101827367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300005719|Ga0068861_102606473Not Available509Open in IMG/M
3300005764|Ga0066903_104181288Not Available772Open in IMG/M
3300005841|Ga0068863_102465425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300006178|Ga0075367_10811448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300006791|Ga0066653_10150151Not Available1133Open in IMG/M
3300007076|Ga0075435_100683258Not Available892Open in IMG/M
3300007076|Ga0075435_101573491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria577Open in IMG/M
3300009090|Ga0099827_11153727Not Available673Open in IMG/M
3300009101|Ga0105247_10030343All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3276Open in IMG/M
3300009101|Ga0105247_11120178All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300009148|Ga0105243_11336242Not Available735Open in IMG/M
3300009162|Ga0075423_12700086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300010043|Ga0126380_11374727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300010046|Ga0126384_12271082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300010321|Ga0134067_10487126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300010336|Ga0134071_10809002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300010337|Ga0134062_10729882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300010360|Ga0126372_12383674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300010361|Ga0126378_12693564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300010366|Ga0126379_12275902Not Available642Open in IMG/M
3300010376|Ga0126381_103861437Not Available585Open in IMG/M
3300010398|Ga0126383_12987691Not Available552Open in IMG/M
3300010403|Ga0134123_12020574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300012096|Ga0137389_10824924All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300012189|Ga0137388_10781624Not Available885Open in IMG/M
3300012948|Ga0126375_10768059Not Available759Open in IMG/M
3300012948|Ga0126375_11649960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300012951|Ga0164300_10134901Not Available1135Open in IMG/M
3300012951|Ga0164300_10338895Not Available802Open in IMG/M
3300012951|Ga0164300_10862156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300012971|Ga0126369_10627618Not Available1147Open in IMG/M
3300012971|Ga0126369_10795866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1027Open in IMG/M
3300013102|Ga0157371_10712481Not Available752Open in IMG/M
3300014968|Ga0157379_10956385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria815Open in IMG/M
3300015358|Ga0134089_10540366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300015372|Ga0132256_101076234Not Available919Open in IMG/M
3300015373|Ga0132257_100760247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601207Open in IMG/M
3300016270|Ga0182036_11434076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300016387|Ga0182040_11435327Not Available585Open in IMG/M
3300017792|Ga0163161_10805914Not Available789Open in IMG/M
3300018482|Ga0066669_11100432Not Available717Open in IMG/M
3300021510|Ga0222621_1086317Not Available664Open in IMG/M
3300025925|Ga0207650_11061637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300025931|Ga0207644_11859920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300025935|Ga0207709_11493442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300025937|Ga0207669_10899690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria739Open in IMG/M
3300025937|Ga0207669_11198771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300026088|Ga0207641_12074307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300026542|Ga0209805_1146930Not Available1088Open in IMG/M
3300026557|Ga0179587_11158075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300027874|Ga0209465_10513823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300027874|Ga0209465_10549642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300027903|Ga0209488_10139735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601828Open in IMG/M
3300028536|Ga0137415_10532115Not Available984Open in IMG/M
3300028704|Ga0307321_1013650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601389Open in IMG/M
3300028784|Ga0307282_10303800Not Available769Open in IMG/M
3300028819|Ga0307296_10774038Not Available523Open in IMG/M
3300028828|Ga0307312_10240749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1169Open in IMG/M
3300031226|Ga0307497_10068481Not Available1300Open in IMG/M
3300031543|Ga0318516_10255411Not Available1013Open in IMG/M
3300031545|Ga0318541_10619201Not Available605Open in IMG/M
3300031546|Ga0318538_10576195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300031572|Ga0318515_10340333Not Available804Open in IMG/M
3300031680|Ga0318574_10330477Not Available887Open in IMG/M
3300031680|Ga0318574_10349009Not Available863Open in IMG/M
3300031723|Ga0318493_10652163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300031724|Ga0318500_10521094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300031765|Ga0318554_10660609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria587Open in IMG/M
3300031771|Ga0318546_11236502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031777|Ga0318543_10178085Not Available940Open in IMG/M
3300031780|Ga0318508_1046484Not Available1138Open in IMG/M
3300031792|Ga0318529_10184203Not Available966Open in IMG/M
3300031819|Ga0318568_10760401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300031832|Ga0318499_10102644Not Available1106Open in IMG/M
3300031835|Ga0318517_10254631Not Available792Open in IMG/M
3300031846|Ga0318512_10201519Not Available973Open in IMG/M
3300031860|Ga0318495_10287733Not Available732Open in IMG/M
3300031890|Ga0306925_10904345Not Available907Open in IMG/M
3300031908|Ga0310900_10277528Not Available1220Open in IMG/M
3300031942|Ga0310916_10678694Not Available872Open in IMG/M
3300031942|Ga0310916_11038961Not Available682Open in IMG/M
3300031945|Ga0310913_10022862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603907Open in IMG/M
3300031954|Ga0306926_11074388Not Available953Open in IMG/M
3300031954|Ga0306926_12165542All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300032013|Ga0310906_10090394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1650Open in IMG/M
3300032013|Ga0310906_10398389Not Available908Open in IMG/M
3300032068|Ga0318553_10222688Not Available984Open in IMG/M
3300032089|Ga0318525_10547257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300032094|Ga0318540_10432763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300033551|Ga0247830_10447008Not Available1011Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_061752302124908045SoilSEREAAEKVCGRALTNRGTLAQLRARVLTFGDFKQRSATSFYAAE
JGI10216J12902_10015492633300000956SoilEAGRLAQLRARVLTLGDLRQTRATPFYAVERGTL*
JGI10216J12902_10228060033300000956SoilSREHNWKKVVAGSAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAD*
Ga0066869_1003875223300005165SoilVEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATEFYAAE*
Ga0070670_10033453413300005331Switchgrass RhizosphereAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD*
Ga0070680_10172493513300005336Corn RhizosphereEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQWSATPFYDAE*
Ga0070662_10142741413300005457Corn RhizosphereAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0070706_10079209413300005467Corn, Switchgrass And Miscanthus RhizosphereAASEKEAAEKVCGLALSEHGTLAQLRARVLTFGDLKQRSATSFYIVE*
Ga0070693_10100337913300005547Corn, Switchgrass And Miscanthus RhizosphereEHNWKKVEAASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYAAE*
Ga0070665_10182736713300005548Switchgrass RhizosphereASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0068861_10260647313300005719Switchgrass RhizosphereRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD*
Ga0066903_10418128813300005764Tropical Forest SoilRKVEAASAKEAAEKMCGAALVEHGRLAQLRARVLAVGDLKQRSATAFYAPE*
Ga0068863_10246542513300005841Switchgrass RhizosphereGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0075367_1081144813300006178Populus EndosphereNWKKVVAGSAKEAAEKVCGRPLKQDGKLAQLRARVLAFGDLKQHSATEFYAAD*
Ga0066653_1015015133300006791SoilLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE*
Ga0075435_10068325813300007076Populus RhizosphereKVCGLPLTERGTLAQLRARVLAFGDLKQRSATSFYAAK*
Ga0075435_10157349113300007076Populus RhizosphereNWKKVEAASEKEAAEKVCGRALKQNGKLAQLRARVLTLGDLKQRSATPFYAAE*
Ga0099827_1115372713300009090Vadose Zone SoilAAEKVCGLALTDNGTLARLRARVLTFGDLKQRSATSFYAAE*
Ga0105247_1003034353300009101Switchgrass RhizosphereRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0105247_1112017823300009101Switchgrass RhizosphereEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0105243_1133624233300009148Miscanthus RhizosphereAKEAAEKVCGRPLKQDGKLAQLRARVLALGDLKQHSATPFYDAD*
Ga0075423_1270008623300009162Populus RhizosphereAEKVCGLPLTERGTLAQLRARVLTFGDLKQRTATPFFAAD*
Ga0126380_1137472723300010043Tropical Forest SoilEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYVVK*
Ga0126384_1227108213300010046Tropical Forest SoilEKEAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE*
Ga0134067_1048712613300010321Grasslands SoilAAEKVCGLPLTERGTLAQLRARVLTFGDLKQRSATSFYAASRR*
Ga0134071_1080900213300010336Grasslands SoilLALTDNGTLAQLRARVLTFGDLKRRSATSFYAVE*
Ga0134062_1072988213300010337Grasslands SoilAASDKEAAEKVCGRALSNRGTLAQLRARVLTFGDFKQRSATSFYAAE*
Ga0126372_1238367423300010360Tropical Forest SoilEAAEKVCGLALTEHGTLAQLRARVLTFGNLKQRSATSFYIVE*
Ga0126378_1269356413300010361Tropical Forest SoilEAAEKVCGLTLTERGTLAQPRARVLTFGDLKQRSATSFYAAE*
Ga0126379_1227590223300010366Tropical Forest SoilCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAAE*
Ga0126381_10386143713300010376Tropical Forest SoilKEAAERVCGLRLTERGTLAQLRARVLTFGDLKQRSATSFYAAN*
Ga0126383_1298769113300010398Tropical Forest SoilEAAEKVCGRALIETGRLSQLRARVLQLGDLKQRSATPFYAAEEVGG*
Ga0134123_1202057423300010403Terrestrial SoilAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0137389_1082492413300012096Vadose Zone SoilSEKEAAEKVCGIILAEIGTLAQLRARVLRFGDLKQHSATAFYAAGE*
Ga0137388_1078162413300012189Vadose Zone SoilLALTEAGRLSQLRARVLPFGDLKQRSATAFYAAE*
Ga0126375_1076805913300012948Tropical Forest SoilIEAATAKQAAEKVCGVALTDQGTLARLRARVLVFGDIKQRSATPFYAAD*
Ga0126375_1164996023300012948Tropical Forest SoilGLALTEHGTLAQLRARVLTFGNLKQRSATSFYIVE*
Ga0164300_1013490113300012951SoilAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD*
Ga0164300_1033889513300012951SoilGRALKQDGKLAQLRARVLALGDLKQRSATPFYAAE*
Ga0164300_1086215613300012951SoilAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0126369_1062761813300012971Tropical Forest SoilEKVCGLTLTERGTLAQLRARVLTFGDLKQRSATSFYAVE*
Ga0126369_1079586613300012971Tropical Forest SoilMDNWCKIEAATAKQAAEKVCGVALTDQGTLARLRARVLVFGDLKQRSATPFYAAD*
Ga0157371_1071248123300013102Corn RhizosphereEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD*
Ga0157379_1095638513300014968Switchgrass RhizosphereNWKKVEAASAKAAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE*
Ga0134089_1054036613300015358Grasslands SoilSEKEAAEKVCGLALTQRGTLAQLRARVLTFGDLKQRTATPFFAVE*
Ga0132256_10107623423300015372Arabidopsis RhizosphereEKEAAEKVCGLALTDNGTLARLRARVLTFGDLKQRSATSFYAVE*
Ga0132257_10076024713300015373Arabidopsis RhizosphereEAAEMVCGLPLSEQGQLSRLRARVLKFGDLKQRSATSFYAAE*
Ga0182036_1143407623300016270SoilGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD
Ga0182040_1143532713300016387SoilRKVKASSAKEAAEKVCGRALSEAGRHSQLRARVLKFGDLRQRSAAEFYAVD
Ga0163161_1080591413300017792Switchgrass RhizosphereCGLPLTERGTLAQLRARVLAFGDLKQRSATSFYAAK
Ga0066669_1110043213300018482Grasslands SoilVCGLNLTHRGTLAQLRARVLTFGALKHRTATPFRVVE
Ga0222621_108631713300021510Groundwater SedimentEKVCGRPLKQDGKLAQLRARVLTLGDLKQHSATAFYAAE
Ga0207650_1106163723300025925Switchgrass RhizosphereEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD
Ga0207644_1185992013300025931Switchgrass RhizosphereASAKAAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE
Ga0207709_1149344213300025935Miscanthus RhizosphereKVEVASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD
Ga0207669_1089969023300025937Miscanthus RhizosphereVCGRPLKQDGKLAQLRARVLAFGDLKQHSATEFYAAD
Ga0207669_1119877123300025937Miscanthus RhizosphereEAASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE
Ga0207641_1207430713300026088Switchgrass RhizosphereEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE
Ga0209805_114693053300026542SoilAASEKEAAEKICGRALNKRGNLAQLRARVLALGDLKQHTATPFYAAD
Ga0179587_1115807523300026557Vadose Zone SoilVCGLALTEAGKLAQLRARVLKFGDLKQRSATQFYAVE
Ga0209465_1051382313300027874Tropical Forest SoilKEAAEKVCGLALTEHGTLAQLRARVLTFGDLKRRSATSFYIVE
Ga0209465_1054964213300027874Tropical Forest SoilKEAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE
Ga0209488_1013973543300027903Vadose Zone SoilEKEAAEKVCGLELRDCGTLAQLRARVLTFGNLKQRTATPFYAAE
Ga0137415_1053211513300028536Vadose Zone SoilKVCGLALRDCGTLAQLRARVLTFGNLKQRTATPFYAAE
Ga0307321_101365013300028704SoilEKEAAEKVCGRPLKQDGKLAQLRARVLTLGDLKQHSATAFYAAE
Ga0307282_1030380013300028784SoilKKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAE
Ga0307296_1077403813300028819SoilKVCGRALKQDGKLAQLRARVLTLGDLKQHSATAFYAAE
Ga0307312_1024074933300028828SoilSAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE
Ga0307497_1006848113300031226SoilCGRALKQDGKLAQLRARVLTLGDLKQRSATEFYAAE
Ga0318516_1025541113300031543SoilKEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK
Ga0318541_1061920113300031545SoilWDREQNWRKVEASSAKEAAEKVCGRVLSGAGRHSQLRARVLKFCDLRQRSAMEFYAID
Ga0318538_1057619523300031546SoilASEKEAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE
Ga0318515_1034033313300031572SoilCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318574_1033047713300031680SoilKEAAEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318574_1034900913300031680SoilKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318493_1065216313300031723SoilCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD
Ga0318500_1052109423300031724SoilEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD
Ga0318554_1066060923300031765SoilQVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE
Ga0318546_1123650223300031771SoilEAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318543_1017808513300031777SoilEAAEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318508_104648423300031780SoilEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK
Ga0318529_1018420313300031792SoilRKEAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318568_1076040113300031819SoilAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD
Ga0318499_1010264423300031832SoilGLALTENGTLAQLRARVLTFGDLKHRSATSFYAVK
Ga0318517_1025463113300031835SoilGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318512_1020151913300031846SoilAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK
Ga0318495_1028773313300031860SoilAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE
Ga0306925_1090434523300031890SoilAEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0310900_1027752823300031908SoilASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD
Ga0310916_1067869413300031942SoilEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0310916_1103896123300031942SoilKEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0310913_1002286253300031945SoilRLAASKEAAEKVCGRTLKEAGKLAQLRARVLTLGDLKQHAATPFYAAD
Ga0306926_1107438813300031954SoilLNWRKVEAASAKEAAEKVCGRVLSEAGRHSQLRARVLKFGDLRQRSAMEFYAID
Ga0306926_1216554223300031954SoilGFALAQTGRLAQLRARVLRLGDLRQRSATEFYAVE
Ga0310906_1009039413300032013SoilWSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAD
Ga0310906_1039838913300032013SoilNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD
Ga0318553_1022268813300032068SoilEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE
Ga0318525_1054725723300032089SoilEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE
Ga0318540_1043276323300032094SoilEAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYVVK
Ga0247830_1044700813300033551SoilAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.