Basic Information | |
---|---|
Family ID | F105723 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 37 residues |
Representative Sequence | KADALVSAAFAELDSFGERAETLKELARYLVERKK |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.02 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.00 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF02537 | CRCB | 29.00 |
PF02585 | PIG-L | 16.00 |
PF02463 | SMC_N | 10.00 |
PF13302 | Acetyltransf_3 | 5.00 |
PF00903 | Glyoxalase | 2.00 |
PF00156 | Pribosyltran | 2.00 |
PF07676 | PD40 | 2.00 |
PF12833 | HTH_18 | 2.00 |
PF00343 | Phosphorylase | 1.00 |
PF00501 | AMP-binding | 1.00 |
PF01242 | PTPS | 1.00 |
PF01435 | Peptidase_M48 | 1.00 |
PF01227 | GTP_cyclohydroI | 1.00 |
PF12706 | Lactamase_B_2 | 1.00 |
PF00180 | Iso_dh | 1.00 |
PF08031 | BBE | 1.00 |
PF02517 | Rce1-like | 1.00 |
PF12704 | MacB_PCD | 1.00 |
PF02641 | DUF190 | 1.00 |
PF06470 | SMC_hinge | 1.00 |
PF00924 | MS_channel | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 29.00 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 16.00 |
COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 1.00 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.00 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.00 |
COG1196 | Chromosome segregation ATPase Smc | Cell cycle control, cell division, chromosome partitioning [D] | 1.00 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 1.00 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.00 % |
Unclassified | root | N/A | 14.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01E1IXW | Not Available | 542 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_103965495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 576 | Open in IMG/M |
3300005576|Ga0066708_10305477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1019 | Open in IMG/M |
3300005602|Ga0070762_10261530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1079 | Open in IMG/M |
3300005610|Ga0070763_10758670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 571 | Open in IMG/M |
3300005843|Ga0068860_100238106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1770 | Open in IMG/M |
3300005874|Ga0075288_1019734 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300005921|Ga0070766_10029054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2993 | Open in IMG/M |
3300006041|Ga0075023_100032549 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300006173|Ga0070716_101001407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300006800|Ga0066660_11114577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
3300009101|Ga0105247_10756683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300009519|Ga0116108_1031759 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300009630|Ga0116114_1115598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300009638|Ga0116113_1167838 | Not Available | 556 | Open in IMG/M |
3300009665|Ga0116135_1400013 | Not Available | 557 | Open in IMG/M |
3300009792|Ga0126374_11595298 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300010343|Ga0074044_10660783 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010343|Ga0074044_10967352 | Not Available | 557 | Open in IMG/M |
3300010366|Ga0126379_10191024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1958 | Open in IMG/M |
3300011120|Ga0150983_14118310 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300011269|Ga0137392_10201850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1626 | Open in IMG/M |
3300012208|Ga0137376_11761765 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300012209|Ga0137379_10764931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6 | 871 | Open in IMG/M |
3300012351|Ga0137386_10482863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300012532|Ga0137373_11119184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300012923|Ga0137359_11671280 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012925|Ga0137419_10724463 | Not Available | 809 | Open in IMG/M |
3300012930|Ga0137407_11834621 | Not Available | 578 | Open in IMG/M |
3300012951|Ga0164300_10882153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300012971|Ga0126369_10488874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
3300012986|Ga0164304_11114112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300013297|Ga0157378_12081149 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300014159|Ga0181530_10204821 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300014168|Ga0181534_10948231 | Not Available | 517 | Open in IMG/M |
3300014498|Ga0182019_10884942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300015264|Ga0137403_11337656 | Not Available | 563 | Open in IMG/M |
3300016750|Ga0181505_10445333 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300017930|Ga0187825_10173828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300018003|Ga0187876_1285507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300018006|Ga0187804_10014681 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
3300018008|Ga0187888_1189193 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300018012|Ga0187810_10200539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 811 | Open in IMG/M |
3300018034|Ga0187863_10060130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2159 | Open in IMG/M |
3300018037|Ga0187883_10158252 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300018082|Ga0184639_10395218 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300018085|Ga0187772_10336809 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300018085|Ga0187772_10360701 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300018089|Ga0187774_10931012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300018468|Ga0066662_12752279 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300020581|Ga0210399_11132440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300020581|Ga0210399_11608171 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300020583|Ga0210401_10165267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2065 | Open in IMG/M |
3300021178|Ga0210408_10392182 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300021406|Ga0210386_11263594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300021432|Ga0210384_11726683 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300021475|Ga0210392_10224238 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300021476|Ga0187846_10409914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300021559|Ga0210409_11011632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 705 | Open in IMG/M |
3300021560|Ga0126371_10736400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1133 | Open in IMG/M |
3300025905|Ga0207685_10398035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300025906|Ga0207699_10786560 | Not Available | 699 | Open in IMG/M |
3300025939|Ga0207665_10905108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300026318|Ga0209471_1155260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 940 | Open in IMG/M |
3300026320|Ga0209131_1015890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4592 | Open in IMG/M |
3300026552|Ga0209577_10853738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
3300027432|Ga0209421_1128840 | Not Available | 521 | Open in IMG/M |
3300027537|Ga0209419_1042292 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300027696|Ga0208696_1276976 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300027729|Ga0209248_10173081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300027803|Ga0209910_10015349 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300027854|Ga0209517_10550253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300027895|Ga0209624_10119091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1733 | Open in IMG/M |
3300027905|Ga0209415_10623562 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300028016|Ga0265354_1028564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300028747|Ga0302219_10365483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300028792|Ga0307504_10119398 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300029923|Ga0311347_10471540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300029944|Ga0311352_10731625 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300029990|Ga0311336_10289594 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300030007|Ga0311338_10009224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14853 | Open in IMG/M |
3300030007|Ga0311338_10701305 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300030490|Ga0302184_10218544 | Not Available | 792 | Open in IMG/M |
3300030518|Ga0302275_10218232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1114 | Open in IMG/M |
3300031028|Ga0302180_10402814 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031234|Ga0302325_10342642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2381 | Open in IMG/M |
3300031234|Ga0302325_10945871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1187 | Open in IMG/M |
3300031258|Ga0302318_10186150 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300031910|Ga0306923_11378884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 744 | Open in IMG/M |
3300031946|Ga0310910_10257978 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300031962|Ga0307479_11286991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
3300032160|Ga0311301_10717135 | Not Available | 1400 | Open in IMG/M |
3300032160|Ga0311301_12688889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300032782|Ga0335082_10977683 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300032829|Ga0335070_10114940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2792 | Open in IMG/M |
3300032955|Ga0335076_10435169 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300033433|Ga0326726_10177309 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
3300034065|Ga0334827_208750 | Not Available | 582 | Open in IMG/M |
3300034124|Ga0370483_0355944 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.00% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_00253210 | 2170459005 | Grass Soil | SVKKADALVASAFTQLDPFGERAATLKEIARYLVERKK |
INPhiseqgaiiFebDRAFT_1039654952 | 3300000364 | Soil | ADALVNDAFAELDSFGERAEPLKELARFLVERKK* |
Ga0066708_103054771 | 3300005576 | Soil | ADTLVDTAFVELDSFGPAAGTLKALARFLVERRK* |
Ga0070762_102615301 | 3300005602 | Soil | RADGLVSKAFTELEPFGARAETLKDLARYLVERKK* |
Ga0070763_107586701 | 3300005610 | Soil | KKADTLVANAFAELSPFGNRAETLKALARYLVERKK* |
Ga0068860_1002381061 | 3300005843 | Switchgrass Rhizosphere | RADQLIESAFSALDGFGPGARTLKELARFLVERKN* |
Ga0075288_10197344 | 3300005874 | Rice Paddy Soil | LKKADALVNDAFAELKSFGEQAETLKELAQFLVERKK* |
Ga0070766_100290545 | 3300005921 | Soil | SERKADSLVSAAFSELESFGERAEPLKELARYLVERKK* |
Ga0075023_1000325491 | 3300006041 | Watersheds | EQSLRKADALADQARAQLDQYGEAAATLRDLAHYLVERKK* |
Ga0070716_1010014072 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKADALVAAAVNSLNDFGHADTLKELARFLVERKK* |
Ga0066660_111145772 | 3300006800 | Soil | LKQADTLVDTACASLDSFGAEADTLKSLARFLVERKK* |
Ga0105247_107566831 | 3300009101 | Switchgrass Rhizosphere | AAALVDSALASLDGFGSRANVLKDLARFLVERKK* |
Ga0116108_10317591 | 3300009519 | Peatland | IRKADALVDQACAELNEYGEAASTLKDLAHYLVERKK* |
Ga0116114_11155981 | 3300009630 | Peatland | RQADALADRACAELDEYGEAASTLKDLARFLVERKK* |
Ga0116113_11678381 | 3300009638 | Peatland | ADELVKSAFTELESFGERAETLRELARFLVERKK* |
Ga0116135_14000131 | 3300009665 | Peatland | LRKGDALVDQACAQLDPFGESATTLKELARFLAKRKS* |
Ga0126374_115952982 | 3300009792 | Tropical Forest Soil | GRAVGAGDSQRKADELVTKAFAELDSFGTRAETLKELARFLIERKK* |
Ga0074044_106607831 | 3300010343 | Bog Forest Soil | IRKADALVDRACTQLDEYGAAASTLKDLAHYLVERKK* |
Ga0074044_109673522 | 3300010343 | Bog Forest Soil | ESLRKADALVDRGCAELNEFGQAASTLKELARFLVERKK* |
Ga0126378_117399151 | 3300010361 | Tropical Forest Soil | KSTQMADGLVKKGCAELDSFGRRADTLKELAQFLIKRRN* |
Ga0126379_101910241 | 3300010366 | Tropical Forest Soil | IAESERKADQLVKTALAELDSFRERAATLKELARFLVERKM* |
Ga0150983_141183101 | 3300011120 | Forest Soil | ADSLVNEAFAQLDGFGEQAERLKELARFLVERKK* |
Ga0137392_102018504 | 3300011269 | Vadose Zone Soil | EESERKADSLVSTAFAELESFGERSETLKELARYLVERKK* |
Ga0137376_117617652 | 3300012208 | Vadose Zone Soil | ADTLVDTAFVELDSFGPAAGTLKALARFLVERKK* |
Ga0137379_107649311 | 3300012209 | Vadose Zone Soil | ADALVANAFTQVDPFGERAATLKEIARYLVERKK* |
Ga0137386_104828631 | 3300012351 | Vadose Zone Soil | RADALVNDAFAELDSFGERAEPLKELARFLVERKK* |
Ga0137373_111191841 | 3300012532 | Vadose Zone Soil | ESRKRADALLASACEALNSFGARAETLQTIARFLVERKN* |
Ga0137359_116712802 | 3300012923 | Vadose Zone Soil | SAHKADSLVSAAFAELESFGERAETLKELARYLVERKK* |
Ga0137419_107244631 | 3300012925 | Vadose Zone Soil | ADQLVKDAFESLESFGVRAETLKTLARFLVERKK* |
Ga0137407_118346211 | 3300012930 | Vadose Zone Soil | ADALVNEAFAELESFGEQAETLKELARFLVERKK* |
Ga0164300_108821532 | 3300012951 | Soil | QKAEALVNTAFSELKSFGERAETLKELARFLVERKK* |
Ga0126369_104888742 | 3300012971 | Tropical Forest Soil | ADALVASAYAQLAPFGERAATLKEIARYLVERKK* |
Ga0164304_111141122 | 3300012986 | Soil | ADALVASGCANLDNFGERAATLKELAAFLVQRKS* |
Ga0157378_120811491 | 3300013297 | Miscanthus Rhizosphere | VRKSVVLVASALASLAGFGPRAEALKEVARFLVERKK* |
Ga0181530_102048211 | 3300014159 | Bog | IRKADALVDQACTQLGEYGESAATLKALAHYLAERKK* |
Ga0181534_109482311 | 3300014168 | Bog | IDESLRKADALVEQACSQIDQFGESADTLKELARFLAERKN* |
Ga0182019_108849422 | 3300014498 | Fen | RNRSKAETLVEKACAELNEYGAAASTLGDLARFLVERKK* |
Ga0137403_113376561 | 3300015264 | Vadose Zone Soil | DESLKKADTLIRSAFLELAVFGARAETLKDLARYLVERKK* |
Ga0181505_104453331 | 3300016750 | Peatland | KADALVDQACAELDKYGEAAATLKDLARYLVERKK |
Ga0187825_101738282 | 3300017930 | Freshwater Sediment | RKADALVSDAFSELESFGERAEPLKELARFLVERKS |
Ga0187876_12855071 | 3300018003 | Peatland | RKADALVNQAFAELDGFGDRADTLKELARFLVERKK |
Ga0187804_100146811 | 3300018006 | Freshwater Sediment | RKADALVDQACAELDEYGEAAATLIDLAHYLVERKK |
Ga0187888_11891931 | 3300018008 | Peatland | LRKADALVDQACAQLDPFGESATTLKELARFLAKRKS |
Ga0187810_102005391 | 3300018012 | Freshwater Sediment | RADALVNEAFSELDSFGERAETLKELARFLVERKK |
Ga0187863_100601305 | 3300018034 | Peatland | GSLKKSDSLFETGFIALDSFWSRADPLKSLARFLVERKK |
Ga0187883_101582521 | 3300018037 | Peatland | LRKADTLVETALGSLEAFGSRADTLKGLARFLVERKK |
Ga0184639_103952181 | 3300018082 | Groundwater Sediment | EKSLEMAGAQVKEACAALDSFGPKAEVLQALARFLVERKK |
Ga0187772_103368091 | 3300018085 | Tropical Peatland | KADALVNDAFKELAGFGERAETLKDLARFLVERKK |
Ga0187772_103607013 | 3300018085 | Tropical Peatland | SIRKADALVQEAFAELDSFGERAEPLRELARFLVERKK |
Ga0187774_109310122 | 3300018089 | Tropical Peatland | DESLRKADALVDRACAELNEFGSAASTLKELARFLVERKK |
Ga0066662_127522791 | 3300018468 | Grasslands Soil | ASERKANELVESAFSHLPPFGERAETLKELARFLVERKK |
Ga0210399_111324402 | 3300020581 | Soil | TRADALVSDAFAELESFGEHAEPLKEVARFLVERKK |
Ga0210399_116081711 | 3300020581 | Soil | IEAATRKADVLVNDAFSELQSFGERAETLKELARFLVERKK |
Ga0210401_101652671 | 3300020583 | Soil | ESLKKADKLVAEAFVQLDPFGGRANTLKELARYLVERKK |
Ga0210408_103921821 | 3300021178 | Soil | SLKKADALVEAALSSLSSFGSRADNLKSLARFLVERKS |
Ga0210386_112635941 | 3300021406 | Soil | QKADALVQQAFAELESFGERAEPLKELARFLVERKK |
Ga0210384_117266832 | 3300021432 | Soil | RKADSLVSAAFAELESFGDRAETLKELARYLVERKK |
Ga0210392_102242381 | 3300021475 | Soil | RKADSLVNEAFAQLDGFGEPAERLKELARFLVERKK |
Ga0187846_104099142 | 3300021476 | Biofilm | SIRKADALVTDAFAELDVFGERAETLKELARFLVERKK |
Ga0210409_110116322 | 3300021559 | Soil | KADSLVSTALAELDSFGDRAGTLKELARYLVERKK |
Ga0126371_107364001 | 3300021560 | Tropical Forest Soil | QQKADELVGKAFAELESFGPRAETLKELARFLIERKK |
Ga0207685_103980351 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SVRNADTLVNDAFSELASFGERAETLKELARFLVERKK |
Ga0207699_107865602 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MADALVNKACSDLDSFGARAETLKSLARFLVERKK |
Ga0207665_109051081 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKADALVAAAVNSLNDFGHADTLKELARFLVERKK |
Ga0209471_11552602 | 3300026318 | Soil | LKQADTLVDTACTSLDSFGPAADTLKALARFLVERKK |
Ga0209131_10158902 | 3300026320 | Grasslands Soil | KADALVDHACDELNEFGSQASTLKDLARFLVERKK |
Ga0209577_108537382 | 3300026552 | Soil | SLKQADTLVDTACTSLDSFGPAADTLKALARFLVERKK |
Ga0209421_11288401 | 3300027432 | Forest Soil | ERKADSLVSAAFSELESFGERAETLKELARYLVERKK |
Ga0209419_10422921 | 3300027537 | Forest Soil | KADALVSEAFAELDSFGEKAETLKELARFLVERKK |
Ga0208696_12769761 | 3300027696 | Peatlands Soil | QKADKLVDTGCAALDSFGARAETLKALARFLVERKR |
Ga0209248_101730812 | 3300027729 | Bog Forest Soil | ESERKADSLVNKGLAELDSFGQRAETLKELARYLVERKK |
Ga0209910_100153492 | 3300027803 | Thawing Permafrost | VRKADALVSTAFSELESFGERAETLKELARYLVERKK |
Ga0209517_105502531 | 3300027854 | Peatlands Soil | KADALVSAAFAELDSFGERAETLKELARYLVERKK |
Ga0209624_101190914 | 3300027895 | Forest Soil | KADSLVEAADTALDSFGSRADALKALARFLVERKK |
Ga0209415_106235622 | 3300027905 | Peatlands Soil | RKADALVNEAFAELDSFGEHAETLKGLARFLVERKK |
Ga0265354_10285642 | 3300028016 | Rhizosphere | LKKADALVETALDSLGIFGSRADTLKALARFLVERKK |
Ga0302219_103654831 | 3300028747 | Palsa | KADSLVDAAFSELESFGERAETLKELARYLVERKK |
Ga0307504_101193981 | 3300028792 | Soil | LRKADALVDQACGELNEFGPAASTLKDLARFLVERKK |
Ga0311347_104715401 | 3300029923 | Fen | SLHKADALVDQACAELNEFGSRASTLKDLARFLVERKK |
Ga0311352_107316252 | 3300029944 | Palsa | SVRKADGLVSEAFEELESFGERAETLKELARYLVERKK |
Ga0311336_102895942 | 3300029990 | Fen | KADVLVNQACAQLDDYGEAASTLKALAHYLVERKK |
Ga0311338_1000922413 | 3300030007 | Palsa | IEESVGKADSLVNAALLELESFGERAGTLKELARYLVERKK |
Ga0311338_107013051 | 3300030007 | Palsa | ASERKADALVSEAFAELESFGEQGEKLKELARFLVERKK |
Ga0302184_102185441 | 3300030490 | Palsa | VHRANALVSTAFLELEGFGERADTLKELARYLVERKK |
Ga0302275_102182323 | 3300030518 | Bog | ESLKRADVLVESAFASLDGFGERGETLKALARFLVERKK |
Ga0302180_104028142 | 3300031028 | Palsa | KESLRKADALVDQACQELRTYGETASVLEDLARFLVQRKK |
Ga0302325_103426424 | 3300031234 | Palsa | RKADSLVSAAFTELDSFGERAEPLKELARYLVERKK |
Ga0302325_109458711 | 3300031234 | Palsa | RKADELVKSAFAELESFGDRAETLRELARFLVERKK |
Ga0302318_101861502 | 3300031258 | Bog | SLRKADALVDQACAQLDPFGESATTLKELARFLAKRKS |
Ga0306923_113788843 | 3300031910 | Soil | RKADELVDKAFAELESFGPRAENLKELARFLIERKK |
Ga0310910_102579784 | 3300031946 | Soil | TRADALVRGAFAELDSFGARADMLRDLARYLVERKT |
Ga0307479_112869912 | 3300031962 | Hardwood Forest Soil | VEASEHKADALVNEAFAELDCFGAKAETLKELARFLVERKK |
Ga0311301_107171352 | 3300032160 | Peatlands Soil | SIRKADAMVDQACAELNEYGEAASTLKDLAHYLVERKK |
Ga0311301_126888891 | 3300032160 | Peatlands Soil | KADALVNDAFAELDSFGERAESLKELARFLVERKK |
Ga0335082_109776831 | 3300032782 | Soil | EKSQQKADDLVNNAFSQLESFGSSAETLKELARFLVERKK |
Ga0335070_101149406 | 3300032829 | Soil | IETSLDKANALVRDAFKQLDGFGQRAETLKELAQFLIERKK |
Ga0335076_104351694 | 3300032955 | Soil | SVRRADALVNDAFAELDSFGASAEPLKELARFLVERKK |
Ga0326726_101773092 | 3300033433 | Peat Soil | RKGDTLIDQGCAELNEFGSAASTLKDLAHFLVERKK |
Ga0334827_208750_2_115 | 3300034065 | Soil | VQRADALVNQAFPELESFGELAKPLKELARYLVERKK |
Ga0370483_0355944_401_508 | 3300034124 | Untreated Peat Soil | KADALVSSAFKELDTFGDRGEPLKELARYLVERKK |
⦗Top⦘ |