NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105734

Metagenome Family F105734

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105734
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 39 residues
Representative Sequence LDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS
Number of Associated Samples 88
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.000 % of family members)
Environment Ontology (ENVO) Unclassified
(19.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13522GATase_6 32.00
PF00990GGDEF 4.00
PF03965Penicillinase_R 1.00
PF11209LmeA 1.00
PF14417MEDS 1.00
PF00400WD40 1.00
PF12399BCA_ABC_TP_C 1.00
PF00310GATase_2 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.00
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.00 %
UnclassifiedrootN/A18.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104244401Not Available752Open in IMG/M
3300001356|JGI12269J14319_10061487All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300002245|JGIcombinedJ26739_100593383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae985Open in IMG/M
3300003368|JGI26340J50214_10187916All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300004082|Ga0062384_100942142All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005591|Ga0070761_10641245All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005719|Ga0068861_101225432All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005764|Ga0066903_103566260All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300006173|Ga0070716_100754968Not Available749Open in IMG/M
3300006175|Ga0070712_101782549All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009089|Ga0099828_10539937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300009137|Ga0066709_102327508Not Available733Open in IMG/M
3300009148|Ga0105243_10406713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1266Open in IMG/M
3300009525|Ga0116220_10277805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia niigatensis734Open in IMG/M
3300009525|Ga0116220_10586123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300009672|Ga0116215_1427938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300009683|Ga0116224_10153589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300009698|Ga0116216_10573929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300009700|Ga0116217_10538334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300009824|Ga0116219_10268180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300010343|Ga0074044_10610514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300010359|Ga0126376_12586149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300010373|Ga0134128_10613585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1210Open in IMG/M
3300010396|Ga0134126_12889246Not Available520Open in IMG/M
3300012354|Ga0137366_10749834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jejuensis694Open in IMG/M
3300012359|Ga0137385_10746606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia815Open in IMG/M
3300012473|Ga0157340_1027000Not Available517Open in IMG/M
3300014654|Ga0181525_10415816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae739Open in IMG/M
3300014745|Ga0157377_11158791Not Available596Open in IMG/M
3300015242|Ga0137412_10467196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia969Open in IMG/M
3300016357|Ga0182032_10149744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1725Open in IMG/M
3300017823|Ga0187818_10163948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia crassostreae968Open in IMG/M
3300017926|Ga0187807_1257243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300017955|Ga0187817_11099718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300017970|Ga0187783_10058075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2852Open in IMG/M
3300017972|Ga0187781_10420496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300017972|Ga0187781_11047107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300018012|Ga0187810_10232628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300018060|Ga0187765_11377163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300018062|Ga0187784_10152865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1885Open in IMG/M
3300018482|Ga0066669_10043901Not Available2768Open in IMG/M
3300020579|Ga0210407_10611604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300021171|Ga0210405_11016611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300021403|Ga0210397_10844202Not Available708Open in IMG/M
3300021405|Ga0210387_11536557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300021406|Ga0210386_10390079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1199Open in IMG/M
3300021433|Ga0210391_11493572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300021478|Ga0210402_10112147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2458Open in IMG/M
3300024176|Ga0224565_1048242Not Available501Open in IMG/M
3300024245|Ga0247677_1043699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300025315|Ga0207697_10564328Not Available500Open in IMG/M
3300025527|Ga0208714_1089070Not Available620Open in IMG/M
3300025633|Ga0208480_1002065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7140Open in IMG/M
3300025909|Ga0207705_10649567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia820Open in IMG/M
3300025910|Ga0207684_11721072Not Available505Open in IMG/M
3300025921|Ga0207652_11094348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300025922|Ga0207646_10382943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1271Open in IMG/M
3300025922|Ga0207646_10759179Not Available865Open in IMG/M
3300025929|Ga0207664_11356013Not Available631Open in IMG/M
3300025929|Ga0207664_11741931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300025941|Ga0207711_10428870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1230Open in IMG/M
3300027107|Ga0208367_115981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300027158|Ga0208725_1012871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1383Open in IMG/M
3300027676|Ga0209333_1054885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1098Open in IMG/M
3300027853|Ga0209274_10410479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300027853|Ga0209274_10458882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae659Open in IMG/M
3300027855|Ga0209693_10095097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1474Open in IMG/M
3300027884|Ga0209275_10714244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300028742|Ga0302220_10156189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidicola867Open in IMG/M
3300028906|Ga0308309_10238178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1517Open in IMG/M
3300030580|Ga0311355_10477372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1201Open in IMG/M
3300031561|Ga0318528_10739918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300031572|Ga0318515_10033295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2529Open in IMG/M
3300031680|Ga0318574_10102956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1585Open in IMG/M
3300031680|Ga0318574_10542080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae682Open in IMG/M
3300031708|Ga0310686_107644478Not Available606Open in IMG/M
3300031723|Ga0318493_10297042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300031747|Ga0318502_10155831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1305Open in IMG/M
3300031753|Ga0307477_10787121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300031777|Ga0318543_10445354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300031778|Ga0318498_10280687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300031796|Ga0318576_10560790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300031823|Ga0307478_10624722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia901Open in IMG/M
3300031910|Ga0306923_10890897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300031946|Ga0310910_11044214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300031946|Ga0310910_11551133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300031981|Ga0318531_10588916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300032043|Ga0318556_10313372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300032090|Ga0318518_10217245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300032160|Ga0311301_10467516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1889Open in IMG/M
3300032160|Ga0311301_11276111Not Available931Open in IMG/M
3300032160|Ga0311301_11599536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300032261|Ga0306920_100917413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1280Open in IMG/M
3300032261|Ga0306920_102629482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300032770|Ga0335085_10300398Not Available1903Open in IMG/M
3300032770|Ga0335085_10434564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1514Open in IMG/M
3300032770|Ga0335085_10548545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidicola1310Open in IMG/M
3300032783|Ga0335079_11355664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300032829|Ga0335070_11287140Not Available669Open in IMG/M
3300032895|Ga0335074_10020303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9365Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027107Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10424440113300000956SoilGESRELTDMLAAADAALYHAKETGRNKTHVISASAPTA*
JGI12269J14319_1006148733300001356Peatlands SoilDGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS*
JGIcombinedJ26739_10059338333300002245Forest SoilSLDGESRELTDLVAAADAALYHAKDAGRNRTHVIPASASAPAS*
JGI26340J50214_1018791623300003368Bog Forest SoilDGASRELTDLLAAADAALYYAKETGRNKTHVITSAARSS*
Ga0062384_10094214213300004082Bog Forest SoilGVAALDGTSRELTDMLAAADAALYYAKETGRNKTHVSPASAPAS*
Ga0070761_1064124533300005591SoilVAALDGDHRQLTELLAAADAALYHAKVTGRNKTHMISSTAQVSSS*
Ga0068861_10122543213300005719Switchgrass RhizosphereLTSESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP*
Ga0066903_10356626033300005764Tropical Forest SoilSLDGENRELTDLLAAADAALYHAKETGRNKTHVISATSQTA*
Ga0070716_10075496853300006173Corn, Switchgrass And Miscanthus RhizosphereRELTDMLAAADAALYHAKETGRNKTHVISASAPTV*
Ga0070712_10178254923300006175Corn, Switchgrass And Miscanthus RhizosphereSRELTDLLAAADAALYHAKGAGRNRTHMVTANVPAS*
Ga0099828_1053993733300009089Vadose Zone SoilAALDGASRELTDMLAAADAALYYAKETGRNKTHVISATAQAS*
Ga0066709_10232750823300009137Grasslands SoilGESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA*
Ga0105243_1040671313300009148Miscanthus RhizosphereQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP*
Ga0116220_1027780533300009525Peatlands SoilRELTDMLAAADSALYYAKETGRNKTHVITATRQAS*
Ga0116220_1058612313300009525Peatlands SoilLDGVSRELTDMMAAADAALYYAKETGRNKTHAISASAQAS*
Ga0116215_142793813300009672Peatlands SoilASRELTDMMAAADAALYYAKETGRNKTHVIRATAQASS*
Ga0116224_1015358913300009683Peatlands SoilELTDMLAAADSARYYAKETGRNKTHVITATRQAS*
Ga0116216_1057392913300009698Peatlands SoilSRELTDMMAAADAALYYAKETGRNKTHVITSAAQAS*
Ga0116217_1053833433300009700Peatlands SoilAALDGTSRGLTDLLAAADAALYHAKETGRNKTHVLPASAHAF*
Ga0116219_1026818033300009824Peatlands SoilLDGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS*
Ga0074044_1061051423300010343Bog Forest SoilELTDMLAAADAALYYAKETGRNKTHVITATAQAS*
Ga0126376_1258614913300010359Tropical Forest SoilESRELTDMLAAADAALYHAKETGRNKTHVISATSQTA*
Ga0134128_1061358533300010373Terrestrial SoilELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP*
Ga0134126_1288924613300010396Terrestrial SoilGVAALNGESRELTDMLAAADAALYHAKETGRNKTHVISASAPTV*
Ga0137366_1074983413300012354Vadose Zone SoilLDGENRELTDMLAAADAALYYAKETGRNKTHVISAAPSAT*
Ga0137385_1074660613300012359Vadose Zone SoilLDGESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA*
Ga0157340_102700013300012473Arabidopsis RhizosphereESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP*
Ga0181525_1041581613300014654BogNRELTDMLAAADAALYYAKETGRNKTHVSPASAPAS*
Ga0157377_1115879113300014745Miscanthus RhizosphereLNGESRELTDMLAAADAALYHAKETGRNKTHVISASAPTA*
Ga0137412_1046719613300015242Vadose Zone SoilVAALNGEGRELTDMLAAADAALYHAKETGRNKTHVISASAPIA*
Ga0182032_1014974413300016357SoilSLDGETRELTDLLAAADAALYHAKETGRNKTHMISATSQTG
Ga0187818_1016394813300017823Freshwater SedimentSRELTDMMAAADAALYYAKETGRNKTHAISATAQASS
Ga0187807_125724323300017926Freshwater SedimentGVASLDGASRELTDMLAAADAALYYAKETGRNRTHVIPASSQAS
Ga0187817_1109971813300017955Freshwater SedimentLDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS
Ga0187783_1005807513300017970Tropical PeatlandGERRELTDMMAAADAALYYAKETGRNKTHLITATRQAS
Ga0187781_1042049613300017972Tropical PeatlandLDGDSRELTEMLAAADAALYHAKETGRNKTHVVTASAQAS
Ga0187781_1104710733300017972Tropical PeatlandSLDGASRELTDMLAAADAALYYAKETGRNKTHVLPASAQAS
Ga0187810_1023262823300018012Freshwater SedimentVAALDETSRGLTDLLAAADAALYHAKETGRNKTHVLPASAHAS
Ga0187765_1137716313300018060Tropical PeatlandGASRELTDMLAAADAALYHAKETGRNKTHVVTASARAS
Ga0187784_1015286513300018062Tropical PeatlandDGTSPELTDMLAAADAALYYAKETGRNKTHVLPASAQAS
Ga0066669_1004390113300018482Grasslands SoilGESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA
Ga0210407_1061160413300020579SoilSRELTDMLTAADSALYHAKETGRNKTHVVTANAPAS
Ga0210405_1101661123300021171SoilGASRELTDMLAAADAALYYAKETGRNKTHVISATAPAS
Ga0210397_1084420213300021403SoilLDGASRELTDMLAAADAAMYYAKETGRNKTHVITGTAQAT
Ga0210387_1153655713300021405SoilALDRSRRELTDMLNAADAALYHAKETGRNKTHMVTANAPAS
Ga0210386_1039007913300021406SoilRELTDMLNAADAALYHAKETGRNKTHMVTANAPAS
Ga0210391_1149357213300021433SoilVASLDGESRELTDMLAAADSALYYAKETGRNKTHVIHASAQAS
Ga0210402_1011214713300021478SoilETRELTDLLAAADAALYHAKETGRNKTHVITATSQTA
Ga0224565_104824213300024176Plant LitterALDSGSRELTDLMAAADAALYYAKETGRNRTHVISANV
Ga0247677_104369913300024245SoilSQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0207697_1056432823300025315Corn, Switchgrass And Miscanthus RhizosphereSVDEVLRAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0208714_108907023300025527Arctic Peat SoilRELTDMLAAADAALYYAKETGRNKTHVVTATTPAS
Ga0208480_100206563300025633Arctic Peat SoilDGVSRELTDMVAAADAALYYAKEAGRNRTHVSTASAQH
Ga0207705_1064956733300025909Corn RhizosphereESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0207684_1172107213300025910Corn, Switchgrass And Miscanthus RhizosphereVGVAALHGESRELTDMLAAADSALYYAKETGRNKTHSISAAVRAS
Ga0207652_1109434833300025921Corn RhizosphereQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0207646_1038294333300025922Corn, Switchgrass And Miscanthus RhizosphereLTSESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0207646_1075917933300025922Corn, Switchgrass And Miscanthus RhizosphereSLDGESRELTDLLAAADSALYHAKETGRNKTHVISATSQTA
Ga0207664_1135601313300025929Agricultural SoilSRELTDLLAAADAALYHAKETGRNKTHVISATSETA
Ga0207664_1174193123300025929Agricultural SoilVAALDSENRELTDLLTAADAALYHAKETGRNKTHMVTASAPAP
Ga0207711_1042887013300025941Switchgrass RhizosphereSESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP
Ga0208367_11598123300027107Forest SoilDGVSRQLTDMLTAADAALYHAKETGRNKTHVIHASAQAS
Ga0208725_101287113300027158Forest SoilALDGASRKLSDLMATADTALYHAKHTGRNRTHVISASIPNTP
Ga0209333_105488513300027676Forest SoilSSLDGTNRELTDMLAAADAALYYAKETGRNKTHASPASAPAS
Ga0209274_1041047913300027853SoilVAALDGDHRQLTELLAAADAALYHAKVTGRNKTHMISSTAQVSSP
Ga0209274_1045888233300027853SoilSRELTDMLAAADAALYYAKETGRNRTHVIPASASAP
Ga0209693_1009509733300027855SoilSVGVAALSGANCELTDMLAAADTALYHAKVTGRNKTHVISAAAQASSP
Ga0209275_1071424423300027884SoilDGVSQELTDMMAAADAALYHAKETGRNKTHAITASAT
Ga0302220_1015618933300028742PalsaGSNRELTDMLAAADAALYHAKVTGRNKTHVMSATAQVSSP
Ga0308309_1023817833300028906SoilGESRKLTDMLAAADAALYHAKETGRNKTHVVTASARAS
Ga0311355_1047737213300030580PalsaALDGEHRQLTDLLAAADAALYHAKVTGRNKTHLISSTAQVPSS
Ga0318528_1073991823300031561SoilQGGARELADLLAAADAALYHAKETGRNRTHVIPAAAQAS
Ga0318515_1003329533300031572SoilDGASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS
Ga0318574_1010295633300031680SoilDGSNRELADLLAAADAALYHAKETGRNRTHVIPAAAQAS
Ga0318574_1054208033300031680SoilLDGASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS
Ga0310686_10764447813300031708SoilRELTDMLAAADAAMYYAKETGRNRTHVITGTAQAT
Ga0318493_1029704213300031723SoilGVASLDGANRELTDMLAAADAALYYAKETGRNKTHVIPASAPAS
Ga0318502_1015583133300031747SoilGVASLDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS
Ga0307477_1078712123300031753Hardwood Forest SoilDGSRRELTDMLNAADAALYHAKETGRNKTHMVTANAPAS
Ga0318543_1044535413300031777SoilASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS
Ga0318498_1028068713300031778SoilNRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS
Ga0318576_1056079013300031796SoilRERPALDGSNRELADLLAAADAAVYHAKETGRNRTHVIPAAAQAS
Ga0307478_1062472213300031823Hardwood Forest SoilGVSRELTDMLTAADSALYHAKETGRNKTHVVTANAPAS
Ga0306923_1089089733300031910SoilSNRELADLLAAADAALYHAKETGRNRTHVIPAAAQAS
Ga0310910_1104421413300031946SoilVASLDDENRELTDLLAAADAALYHAKETGRNKTHMISATSQTG
Ga0310910_1155113323300031946SoilALDGASRELTEMLAAADAALYHAKETGRNKTHVVTASAEAS
Ga0318531_1058891613300031981SoilDGSNRELADLLAAADAAVYHAKETGRNRTHVIPAAAQAS
Ga0318556_1031337213300032043SoilLDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAPAS
Ga0318518_1021724513300032090SoilITRRARELAYLLAAADAALYHAKETGRNRTHVIPAAAQAS
Ga0311301_1046751613300032160Peatlands SoilGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS
Ga0311301_1127611123300032160Peatlands SoilVVSRELTDMMAAADAALYYAKETGRNKTHAISASAQAS
Ga0311301_1159953633300032160Peatlands SoilVAALDGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS
Ga0306920_10091741313300032261SoilGASRELTEMLAAADAALYHAKETGRNKTHVVTASAEAS
Ga0306920_10262948213300032261SoilSLDGESRELTDLLAAADAALYHAKETGRNKTHLISATSQTA
Ga0335085_1030039833300032770SoilASRELTDLMAAADAALYYAKETGRNKTHVITSAAPAS
Ga0335085_1043456413300032770SoilGESRELTDLLAAADAALYHAKETGRNKTHVISASSQTA
Ga0335085_1054854533300032770SoilASLDGENRELTDLLAAADAALYHAKETGRNKTHVISATSPTA
Ga0335079_1135566433300032783SoilAGRELTDMLAAADAALYHAKETGRNKTHVVTASAQAS
Ga0335070_1128714013300032829SoilSLDGESRELTDLLAAADAALYHAKETGRNKTHVISATSSTT
Ga0335074_10020303103300032895SoilVGIAALDGTARELTDLLAAADSALYYAKDNGRNKTHAMAAVGLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.