 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105748 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GVVYLPNADKYRRLTRRPSQEQKGLDERALMASQRPSPPW |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 2.00 % |
| % of genes from short scaffolds (< 2000 bps) | 1.00 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 2.00 |
| PF13358 | DDE_3 | 2.00 |
| PF13551 | HTH_29 | 1.00 |
| PF04365 | BrnT_toxin | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF12006 | DUF3500 | 1.00 |
| PF06782 | UPF0236 | 1.00 |
| PF03400 | DDE_Tnp_IS1 | 1.00 |
| PF09360 | zf-CDGSH | 1.00 |
| PF00583 | Acetyltransf_1 | 1.00 |
| PF13610 | DDE_Tnp_IS240 | 1.00 |
| PF12762 | DDE_Tnp_IS1595 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.00 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.00 % |
| All Organisms | root | All Organisms | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005553|Ga0066695_10772021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300012350|Ga0137372_10074234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2917 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_105885021 | 3300000953 | Soil | VVSLQRAGKYQRLAWRPSQEQKGLDERALMAALQPSPPS* |
| JGI1027J12803_1094462983 | 3300000955 | Soil | VDGTSLRVVYLYAAAKYHRRTRRLSQEQKGRDERALMAS* |
| JGI25384J37096_101588422 | 3300002561 | Grasslands Soil | RAVYLSPAAKYHRLTRRLSQGQKGLKERALMASQRPSHPW* |
| Ga0066397_100496282 | 3300004281 | Tropical Forest Soil | AVYLPTADKYRRLTRRLSQGQKGLEERALMASQQPSEPW* |
| Ga0066397_100860652 | 3300004281 | Tropical Forest Soil | PVMYLAAAGKYLRLTHRPSQGQKDLDERGIIASQQLSDPW* |
| Ga0066395_100332745 | 3300004633 | Tropical Forest Soil | WVVYLRPADKYPRFTRRLSQEQKGLEERALMASQRPSDPW* |
| Ga0066395_101462562 | 3300004633 | Tropical Forest Soil | VVYLPNADKYRGLTRRPPQGHKGLDERALMASQRPLHPW* |
| Ga0066809_100131872 | 3300005168 | Soil | MSHWVVYLPNADKYRRLTRRPSQGQKGLDERALMASQRPS |
| Ga0066683_107419852 | 3300005172 | Soil | LQQAVYLAAAAKYRRLTHRLSQEQKGLDERALMVSQRPSHLW* |
| Ga0066685_110966171 | 3300005180 | Soil | VVYLSPADKYHRLTRRLPQGQKGLKERAIMASQRPSPPW* |
| Ga0066675_108278852 | 3300005187 | Soil | MVQKPVDNLTLSAAEVVYLLRADKSPRLTCRPSQGQKGLKERALMASQRPSEPW* |
| Ga0065705_101547741 | 3300005294 | Switchgrass Rhizosphere | VVYLSPAGKYKKPAWRLSQEQKGLDERPLKASSRPSEPW* |
| Ga0065705_103985704 | 3300005294 | Switchgrass Rhizosphere | VYLAAAAKYRRLTPRLSQEQKGLDERARTASQWPLPPVDV |
| Ga0070668_1017634831 | 3300005347 | Switchgrass Rhizosphere | AVVYLSPADKYHRLTRRLSQGQKSLDERALLASQWPSEPW* |
| Ga0070667_1007693092 | 3300005367 | Switchgrass Rhizosphere | VVYLLRADKSPRLTRRPSQEQKGLGERARMASQRSSEAW* |
| Ga0070700_1000544174 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYLLRADKSPRLTRRPSQEQKGLDERARMASQRSSEAW* |
| Ga0066682_106517421 | 3300005450 | Soil | VVYLPNADKYRGLTRRPSQGHKGLDERTLMASQRPFHPW* |
| Ga0070706_1016540101 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LVGGIAVVYLEPADKYPRLIRRLPQGQKGLDERALMASRWPSHPW* |
| Ga0070706_1017823441 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFQLIEYWVVYLGPADKYHRFTRRPSQEHKGLDERAIMASQWPS |
| Ga0070697_1018291881 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLPTADKYRRLTRRLSKGQKGLEERARMASQRPSPRMVKKL |
| Ga0070686_1000859831 | 3300005544 | Switchgrass Rhizosphere | MEWVVYLLRADKSPRLTRRPSQEQKGLDERARMASQRSSEAW* |
| Ga0070695_1011696561 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYLPNADKYRRLTRRPSQGQKGLDERTLMASQRPFHPW* |
| Ga0066701_108201701 | 3300005552 | Soil | VVYLSPADKYHRLIRRLSQGQKGLEERDLMASQRPFEPW* |
| Ga0066701_108234631 | 3300005552 | Soil | MIQYKVVYLSPADKYRRLTRRLSQDQKGLEERALMAS |
| Ga0066695_107614211 | 3300005553 | Soil | TVRLGASASPERVVYLPNADKYRGLTHRLLQEQKGLDERALMASQRPSAPW* |
| Ga0066695_107720211 | 3300005553 | Soil | YLSPADKYHRLTRRLSQAQEGLEERALRTSQRPSEPW* |
| Ga0066707_103367562 | 3300005556 | Soil | AVYLAAADKYRRHTHRLSQEHKGLDERALMVSQRRSHLW* |
| Ga0066707_109485981 | 3300005556 | Soil | MQEVVYLSPADKSHRLTRRLSQEQKGLEERALMASQRPSEP |
| Ga0066698_101231392 | 3300005558 | Soil | EAVYLAAAAKYRRLTHRLSQEQKGLDERALMVSQRPSHLW* |
| Ga0066698_101491503 | 3300005558 | Soil | VVYLPNADKYRGLTHRLLQEQKGLDERALMASQRPSAPW* |
| Ga0066694_104380651 | 3300005574 | Soil | RAVYLAAAAKYRRLTHRLSQEQKGLDERALMVSQRPSHLW* |
| Ga0068852_1023180192 | 3300005616 | Corn Rhizosphere | VVYLPNADKYRRLTRRPSQEQKGLDERARMASQRSSEAW* |
| Ga0066905_1020088592 | 3300005713 | Tropical Forest Soil | AAVYLSPADKSHRLTRRLSQEQKGLEERALMASQRPSAPW* |
| Ga0066903_1011370771 | 3300005764 | Tropical Forest Soil | MYLWAADKSPRLTCQLSQEQKGLDERARMASQRPS |
| Ga0066903_1012143893 | 3300005764 | Tropical Forest Soil | VYLPTADKYRRLTRRLSQGQKGLEEWALMASQQPSEPW |
| Ga0066903_1029327981 | 3300005764 | Tropical Forest Soil | AVVYLSPADKYHRLTHRLSQEQKGLEERALMASQRPFHPW* |
| Ga0070716_1005745372 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AVYLHPADKYRRLTYRLSKGQKGLGERALMVSQRLSDS* |
| Ga0066665_101121974 | 3300006796 | Soil | VVYLSPADKYRRLTHRSSQGQKGLAERALMASQWPSHLW* |
| Ga0075428_1003860211 | 3300006844 | Populus Rhizosphere | MTHRRVVYLSPADKYHRLTHRPSQGQKGLDERAIITSPWSSH |
| Ga0075421_1008818873 | 3300006845 | Populus Rhizosphere | AVYLHPADKYYRLTRRPSQGQKGLDERAIMASQWPSHPW* |
| Ga0075421_1010985972 | 3300006845 | Populus Rhizosphere | WVVYLSPADKYRMLTRRLSKDQKGLEERALMASQRPFHPW* |
| Ga0075430_1008509812 | 3300006846 | Populus Rhizosphere | VYLHPAAKYRRLTPRLSQEQKGLDERTRMASQWPSPPGDAFDAGHVT |
| Ga0075430_1014277662 | 3300006846 | Populus Rhizosphere | RHVAVYLHTADKYRRFTRRPPQGQKDLDERARMVS* |
| Ga0075433_108460752 | 3300006852 | Populus Rhizosphere | VVYLSPADKYHRLTHRLSQEQKGLEERALMASQRSFHPW* |
| Ga0075433_115663182 | 3300006852 | Populus Rhizosphere | RVVYLSPADKYRMLTRRLSKDQKGLEERALMASQRPFHPW* |
| Ga0075420_1019224261 | 3300006853 | Populus Rhizosphere | GVVYLPNADKYRRLTRRPSQEQKGLDERALMASQRPSPPW* |
| Ga0075425_1012692873 | 3300006854 | Populus Rhizosphere | VVYLPNADKYRRLTRRPSQGQKGIDERTLMTSQRPFHPW* |
| Ga0075434_1005248184 | 3300006871 | Populus Rhizosphere | MEWAVYLHTADKYRRSTRRPPQGQKGLDERARMVSSR |
| Ga0075429_1007014401 | 3300006880 | Populus Rhizosphere | WAVYLHPADKYRRLTYRLSKGQKGLGERALMVSQRLSDS* |
| Ga0075419_109868862 | 3300006969 | Populus Rhizosphere | MSKLTVVYLPTADKYRGLTRRPLQEQKGLDERALMASQRPSAPW* |
| Ga0075435_1019621171 | 3300007076 | Populus Rhizosphere | RKTPRTRGKWVVYLRPAGKYQRPAWRLSQEQKSLDERPLKASQRPSEPW* |
| Ga0066710_1004911842 | 3300009012 | Grasslands Soil | AVYLAAAAKYRRLTHRLSQEQKGLDERALMVSQRPSHLW |
| Ga0099829_104782871 | 3300009038 | Vadose Zone Soil | MAADNWVVYLHPADNYPSLIRRPSQGQKDLYEKALMASQRPSPP |
| Ga0075418_109555662 | 3300009100 | Populus Rhizosphere | VVYLSPADKYRMLTRRLSKDQKGLEERALMASQRPFHPW* |
| Ga0114129_102700943 | 3300009147 | Populus Rhizosphere | MSKLTVVYLPTADKYRGLTRRPPQEQKGLDERTRMASQRPFPAS* |
| Ga0105069_10348691 | 3300009800 | Groundwater Sand | MKEVVYLATADKYPRLIRRPSQGQKSREERALMASQRPSDPG* |
| Ga0105062_10506141 | 3300009817 | Groundwater Sand | VVYLRSADKYHSLTRRLSQGQKGLHEMALLASQRPSHPW* |
| Ga0105064_10263134 | 3300009821 | Groundwater Sand | ALVVYLPTADKYRRLTRRPLQGQKGLDEKTLLAAQRPLHPW* |
| Ga0126312_114771961 | 3300010041 | Serpentine Soil | VYLAAADKYRRLTHRLSQEPKGIDERAFMAFQRASHSW* |
| Ga0126384_115678932 | 3300010046 | Tropical Forest Soil | WAVYLPTADKYRRLTRRLSQGQKGLEEWALMASQQPSEPW* |
| Ga0134071_103595502 | 3300010336 | Grasslands Soil | DAMPLRVVYLHTADKYHGFTHRPSPGQKGMDEKAIMASQWPSEPW* |
| Ga0126370_119730791 | 3300010358 | Tropical Forest Soil | MVLEARCRVVYLSPADNSLRLTRQLSQGLKVLDEWALMTSQQP |
| Ga0126376_109927601 | 3300010359 | Tropical Forest Soil | AVYLPTADKYRRLTRRLSQGQKGLEERALMASQQPAEPW* |
| Ga0126379_110961132 | 3300010366 | Tropical Forest Soil | VYLHHAAKYRRLTPRLSQEQKGLDERTRMASQWPSPPGDAFDA |
| Ga0134123_132009101 | 3300010403 | Terrestrial Soil | AKRPVVYLHSADKYHRLTRRPLQGQKGLDERPLLASQ* |
| Ga0137391_102514471 | 3300011270 | Vadose Zone Soil | MVSLSPADTYHMRTRRPSQEQKGLDERAIMTSQWPSHPW |
| Ga0137388_116960711 | 3300012189 | Vadose Zone Soil | VVSLGFHRPVVYLHTADKYHRLTRRPSQDQKGLEERPIMVS |
| Ga0137363_107764551 | 3300012202 | Vadose Zone Soil | RSRVALLGVVYLHHADKYHRLTRRLSQGQKSLDERAIMASQRPSHPW* |
| Ga0137380_102609081 | 3300012206 | Vadose Zone Soil | VVYLAAADKYRRLTQRLSQEQKGLDERVLMVSQWPSHLW* |
| Ga0137380_112496891 | 3300012206 | Vadose Zone Soil | HLAVYLHPADKYYRLTRRPSQGQKGLDERAIMASQWPSHPW* |
| Ga0137372_100742343 | 3300012350 | Vadose Zone Soil | VVYLAPADKYRRLTQRLSQEQKGLDERVLMVSQWPSHLW* |
| Ga0137367_100538105 | 3300012353 | Vadose Zone Soil | VVYLHHTDKYPRLTHRLSQEQKGLDKRALMASQRPSEP* |
| Ga0137369_103651253 | 3300012355 | Vadose Zone Soil | VVYLPNADKYRGLTHRLSQGQKGLDERTLMASQRPFHPW* |
| Ga0137360_102607042 | 3300012361 | Vadose Zone Soil | MITVELVVYLSPADKYHRFTRRLSKGQKVLQERALLASQRPSEPW* |
| Ga0137395_105307501 | 3300012917 | Vadose Zone Soil | KFEAESVVYLHPADKYPRLTHRPSQEQKGLYERALMAS* |
| Ga0137395_110803313 | 3300012917 | Vadose Zone Soil | YLLNADKYRGLTRRPLQEQKGLEERTLMASQRPFHPW* |
| Ga0137394_113813821 | 3300012922 | Vadose Zone Soil | VYLPTADTYRGLTRRPSQEQKGLDKRTLMASQQPFHP |
| Ga0126369_119225742 | 3300012971 | Tropical Forest Soil | STAIHMRWAVYLSPAEKYHRLTRRPSQEQKGLDERTLIASQRPFHPW* |
| Ga0157377_103975971 | 3300014745 | Miscanthus Rhizosphere | DIVRRVVYLLRADKSPRLTRRPSQEQKGLDERARMASQRSSEAW* |
| Ga0137403_109403661 | 3300015264 | Vadose Zone Soil | VYLLLADKSHRNTHRLSQGQKGLDERALMASQRPSEPW* |
| Ga0182032_100814011 | 3300016357 | Soil | TWYWVVYLHHADKSHRLTPRLSQEQKGLDERTLMASQRPSEPW |
| Ga0163161_110369441 | 3300017792 | Switchgrass Rhizosphere | NSGALKAAVYLHTADKYRRFTRRPPQEQKGLDERARMVS |
| Ga0190269_115907062 | 3300018465 | Soil | VSASIDELVVSLEPADNSPRLTRRLSQGLKVLDELALMTSQQPSEPW |
| Ga0179596_102067811 | 3300021086 | Vadose Zone Soil | APSVVYLAAADKDRGLTRRPLQEQKGLDKRTLIASQQPFHPW |
| Ga0207684_101924522 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SLHLVVYLPNADKYRGLTRRPSEGQKGLDERALMASQRPFHPW |
| Ga0207689_107651801 | 3300025942 | Miscanthus Rhizosphere | VVYLLRADKSPRLTRRPSQEQKGLGERARMASQRSSEAW |
| Ga0257170_10196582 | 3300026351 | Soil | STVVYLPNADKYRGLTRRPSKGQKGLDERALMASQRPFHPW |
| Ga0209157_12479452 | 3300026537 | Soil | GKSVVYLSPADNSPRLTRRLSQGLKVLDEWALMTSQQLSEPW |
| Ga0209879_10830822 | 3300027056 | Groundwater Sand | HRAGSKEVVYLPTADKYPRLTRRPSQGHKGIDERVLMAS |
| Ga0209843_10271861 | 3300027511 | Groundwater Sand | VVYLAAADKYRRLTHRLSQGQKGLDERALMVSQRLSDP |
| Ga0209843_10359581 | 3300027511 | Groundwater Sand | MVKEVVYLHPADKSPRLTRRLSQGQKGLEERALMASQRPSH |
| Ga0209799_10394751 | 3300027654 | Tropical Forest Soil | NRTAVYLPTADKYRRLTRRLSQGQKGLEERALMASQQPSEPW |
| Ga0209382_101098218 | 3300027909 | Populus Rhizosphere | MCKESLCSAVYLSPADKYHRLTRRLSQGQKGLDERALMAFQRPSEPW |
| Ga0137415_103089561 | 3300028536 | Vadose Zone Soil | GLGAVYLAAAAKYRRLTHRLSQGHKGLDERTLMASQQPFHPW |
| Ga0137415_106175822 | 3300028536 | Vadose Zone Soil | LPAAEPVVYLLAADKYRRLTRRLSQEQKGLDERALMASQRPSHPW |
| Ga0307305_105413141 | 3300028807 | Soil | VVYLPNADKYRGLTHRPLQEQKGLDERALMASQRPSAP |
| Ga0307278_101218612 | 3300028878 | Soil | MSELHDFNQRVVYLSPADKYHRFTRRLSKGQKVLQERALLASQRPSEPW |
| Ga0307473_109234531 | 3300031820 | Hardwood Forest Soil | HWVVYLPNADKYRGLTRRPLQEHKGLDERALMASQRPSAPW |
| Ga0306926_102255513 | 3300031954 | Soil | MEFQGAERWVVYLHPADKYFRLTHRPSQEQKGLDERALMASQRPSPPW |
| Ga0306924_113587152 | 3300032076 | Soil | PQQVVYLSPADKYHRLTRRLSQEQKGLEERALMASQRPSPPW |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |