NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105752

Metagenome / Metatranscriptome Family F105752

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105752
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 45 residues
Representative Sequence NGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADFGVLR
Number of Associated Samples 79
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 1.03 %
% of genes near scaffold ends (potentially truncated) 94.00 %
% of genes from short scaffolds (< 2000 bps) 85.00 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(21.000 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.11%    β-sheet: 0.00%    Coil/Unstructured: 95.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03737RraA-like 12.00
PF02811PHP 8.00
PF13305TetR_C_33 1.00
PF07690MFS_1 1.00
PF00293NUDIX 1.00
PF12728HTH_17 1.00
PF02659Mntp 1.00
PF00753Lactamase_B 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 12.00
COG1971Putative Mn2+ efflux pump MntPInorganic ion transport and metabolism [P] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.00 %
All OrganismsrootAll Organisms42.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01DWI4ANot Available548Open in IMG/M
3300005332|Ga0066388_107195111Not Available559Open in IMG/M
3300005435|Ga0070714_100036770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4109Open in IMG/M
3300005435|Ga0070714_100229307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1710Open in IMG/M
3300005436|Ga0070713_102208101Not Available533Open in IMG/M
3300005437|Ga0070710_10108917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1661Open in IMG/M
3300005437|Ga0070710_10142905Not Available1469Open in IMG/M
3300005437|Ga0070710_10271204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1097Open in IMG/M
3300005437|Ga0070710_10690307Not Available719Open in IMG/M
3300005437|Ga0070710_11201021Not Available560Open in IMG/M
3300005439|Ga0070711_100323197Not Available1233Open in IMG/M
3300005439|Ga0070711_101467340Not Available595Open in IMG/M
3300005439|Ga0070711_101534843Not Available581Open in IMG/M
3300005444|Ga0070694_101020297Not Available687Open in IMG/M
3300005529|Ga0070741_10043066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces5743Open in IMG/M
3300005529|Ga0070741_10104158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2998Open in IMG/M
3300005536|Ga0070697_100605216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300005602|Ga0070762_11199100Not Available525Open in IMG/M
3300005614|Ga0068856_100554441Not Available1170Open in IMG/M
3300005764|Ga0066903_105799992Not Available648Open in IMG/M
3300005891|Ga0075283_1113456Not Available515Open in IMG/M
3300006028|Ga0070717_11028052Not Available750Open in IMG/M
3300006028|Ga0070717_11788237Not Available555Open in IMG/M
3300006032|Ga0066696_10108506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1680Open in IMG/M
3300006173|Ga0070716_100502633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia894Open in IMG/M
3300006175|Ga0070712_100456008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1065Open in IMG/M
3300006175|Ga0070712_101036612Not Available711Open in IMG/M
3300006804|Ga0079221_10128041Not Available1294Open in IMG/M
3300006804|Ga0079221_11101811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae608Open in IMG/M
3300006854|Ga0075425_100952248Not Available980Open in IMG/M
3300007076|Ga0075435_101436467Not Available605Open in IMG/M
3300007076|Ga0075435_101927317Not Available519Open in IMG/M
3300009090|Ga0099827_11145161Not Available676Open in IMG/M
3300009137|Ga0066709_103188004Not Available598Open in IMG/M
3300009174|Ga0105241_12343711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae532Open in IMG/M
3300010321|Ga0134067_10318445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales604Open in IMG/M
3300010358|Ga0126370_11620571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales620Open in IMG/M
3300010366|Ga0126379_11851724Not Available707Open in IMG/M
3300010373|Ga0134128_12515964Not Available567Open in IMG/M
3300010376|Ga0126381_102280922Not Available778Open in IMG/M
3300010376|Ga0126381_102966706Not Available674Open in IMG/M
3300010379|Ga0136449_103427996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales606Open in IMG/M
3300010379|Ga0136449_103926565Not Available557Open in IMG/M
3300010396|Ga0134126_10831661Not Available1042Open in IMG/M
3300010396|Ga0134126_12155668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae608Open in IMG/M
3300010398|Ga0126383_12513766Not Available599Open in IMG/M
3300010399|Ga0134127_11716597Not Available703Open in IMG/M
3300010880|Ga0126350_12140740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300011269|Ga0137392_10449483Not Available1070Open in IMG/M
3300011270|Ga0137391_10187122Not Available1804Open in IMG/M
3300012209|Ga0137379_10098539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2813Open in IMG/M
3300012351|Ga0137386_11011512Not Available591Open in IMG/M
3300012354|Ga0137366_11074689Not Available555Open in IMG/M
3300012924|Ga0137413_11234433Not Available597Open in IMG/M
3300012958|Ga0164299_10296728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales991Open in IMG/M
3300012960|Ga0164301_11113906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales628Open in IMG/M
3300012984|Ga0164309_10610767Not Available853Open in IMG/M
3300013105|Ga0157369_11935603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae598Open in IMG/M
3300014325|Ga0163163_10782473Not Available1017Open in IMG/M
3300014497|Ga0182008_10757844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae560Open in IMG/M
3300015200|Ga0173480_10747236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales619Open in IMG/M
3300015264|Ga0137403_10938686Not Available714Open in IMG/M
3300015372|Ga0132256_101245299Not Available857Open in IMG/M
3300016445|Ga0182038_10491450Not Available1045Open in IMG/M
3300017821|Ga0187812_1020262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2296Open in IMG/M
3300018038|Ga0187855_10320025Not Available907Open in IMG/M
3300021178|Ga0210408_10748134Not Available768Open in IMG/M
3300021374|Ga0213881_10222731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300021444|Ga0213878_10244789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales761Open in IMG/M
3300021475|Ga0210392_11330121Not Available537Open in IMG/M
3300021560|Ga0126371_11636785Not Available769Open in IMG/M
3300021560|Ga0126371_12341676Not Available645Open in IMG/M
3300021560|Ga0126371_12474983Not Available628Open in IMG/M
3300025898|Ga0207692_10029070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2622Open in IMG/M
3300025915|Ga0207693_10379728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1105Open in IMG/M
3300025916|Ga0207663_10030786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3168Open in IMG/M
3300025928|Ga0207700_10561060Not Available1014Open in IMG/M
3300025928|Ga0207700_11786271Not Available541Open in IMG/M
3300025929|Ga0207664_10201243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1719Open in IMG/M
3300025929|Ga0207664_12007846Not Available501Open in IMG/M
3300026078|Ga0207702_12229660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae536Open in IMG/M
3300026118|Ga0207675_100359504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1428Open in IMG/M
3300026551|Ga0209648_10005240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11073Open in IMG/M
3300027725|Ga0209178_1378947Not Available534Open in IMG/M
3300027775|Ga0209177_10039557Not Available1286Open in IMG/M
3300027787|Ga0209074_10158805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae820Open in IMG/M
3300027882|Ga0209590_10022920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus siccatus3183Open in IMG/M
3300028715|Ga0307313_10015635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2005Open in IMG/M
3300031549|Ga0318571_10002664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3420Open in IMG/M
3300031713|Ga0318496_10477379Not Available689Open in IMG/M
3300031805|Ga0318497_10154421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300032076|Ga0306924_10611208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300032174|Ga0307470_10407953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M
3300032174|Ga0307470_11268651Not Available602Open in IMG/M
3300032828|Ga0335080_10065061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4041Open in IMG/M
3300033158|Ga0335077_11576453Not Available626Open in IMG/M
3300034644|Ga0370548_036266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia829Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere21.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil4.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.00%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_037008502170459024Grass SoilPKNGFPTDTPRPQLFVQNLTGFSHGPGTPIGSVQDNQLWGADWGVLR
Ga0062389_10250876523300004092Bog Forest SoilPTDKPRPQLVVTNLTGFSNGTGGPEVNTVNSNQLWGATFGVLP*
Ga0066388_10719511113300005332Tropical Forest SoilDRPRPQLFVNNLTGFSHGIGTPIGSVNDTQLWGANFGVLR*
Ga0070714_10003677013300005435Agricultural SoilNGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADLGVVR*
Ga0070714_10022930733300005435Agricultural SoilHPFVLSYPANGFPTDKPRPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0070713_10220810123300005436Corn, Switchgrass And Miscanthus RhizosphereFPTDKPRPQLFVSNLDGFQTTIGTPIGSVNDFQLWGADFGVLR*
Ga0070710_1010891733300005437Corn, Switchgrass And Miscanthus RhizosphereNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR*
Ga0070710_1014290513300005437Corn, Switchgrass And Miscanthus RhizosphereNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADFGVLR*
Ga0070710_1027120413300005437Corn, Switchgrass And Miscanthus RhizosphereSYPANGFPTDKPRPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0070710_1069030723300005437Corn, Switchgrass And Miscanthus RhizosphereMTYPKNGFPTDTPRPQVFVQNLTGFSHGFGSPIGSVQDNQLWGADFGVLR*
Ga0070710_1120102113300005437Corn, Switchgrass And Miscanthus RhizosphereNGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0070711_10032319723300005439Corn, Switchgrass And Miscanthus RhizosphereANGFPTDKPRPQIFVNNLTGFSHGIGTPIGSVDDTQLWGADFGNLR*
Ga0070711_10146734023300005439Corn, Switchgrass And Miscanthus RhizosphereRPRPQLLVQNLTGFTQGHFPHGTPIGNVDDNQLWGADWGILR*
Ga0070711_10153484313300005439Corn, Switchgrass And Miscanthus RhizospherePTDKPRPQIFVNNLTGFSHGIGTPIGSVDDTQLWGANFGPNR*
Ga0070694_10102029723300005444Corn, Switchgrass And Miscanthus RhizosphereRPQLLVQNLTGFTQGHFPIGSPIGNVDDNQLWGADWGILR*
Ga0070741_1004306673300005529Surface SoilNGFPTDRPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADQGVLR*
Ga0070741_1010415853300005529Surface SoilNGFPTDRPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADFGNLR*
Ga0070697_10060521613300005536Corn, Switchgrass And Miscanthus RhizosphereTYPKNGYPTDTPRPQVMVQNLTGFSHGPGTPIGSVQDNQLWGADWGVLR*
Ga0070730_1053720913300005537Surface SoilDMPRPQLTVTNLTGFSNGWGPEIGTVESSQLWGADYGVLS*
Ga0070762_1119910013300005602SoilPRPQLLVQNLTGFTQGHFPIGSPIGNVNDNQLWGADWGILR*
Ga0068856_10055444123300005614Corn RhizosphereVPVTDRPRPQLFTQNLTGFSHGFGSPIGSVQDNQLWGADFGILR*
Ga0066903_10579999213300005764Tropical Forest SoilNGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVSDFQLWGANFGVLR*
Ga0075283_111345613300005891Rice Paddy SoilLLTQNLTGFTQGHYPLGSPIGNVNDNQLWGADWGILR*
Ga0070717_1102805233300006028Corn, Switchgrass And Miscanthus RhizosphereANGFPTDKPRPQLQVKNLTGFSHGIGTPIGSVQDIQLWGADFGVLR*
Ga0070717_1178823723300006028Corn, Switchgrass And Miscanthus RhizosphereDKPRPQLQVKNLTGFSHGIGTPIGSVNDTQLWGADFGVLR*
Ga0066696_1010850613300006032SoilLTYPKNGYPTDRPRPQLLTQNLTGFSQGHYPLGTPIGNVNDNQLWGADWGILR*
Ga0070716_10050263323300006173Corn, Switchgrass And Miscanthus RhizospherePQLQVKNLTGFSHGIGTPIGSVDDTQLWGADVGVLR*
Ga0070712_10045600823300006175Corn, Switchgrass And Miscanthus RhizosphereFPTDKPRPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADVGVLR*
Ga0070712_10103661213300006175Corn, Switchgrass And Miscanthus RhizosphereNGFPTDKPRPQLQVRNLTGFSNGIGRVVGTVIDTQLWGANFGVGR*
Ga0079221_1012804123300006804Agricultural SoilGNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADFGVLR*
Ga0079221_1110181123300006804Agricultural SoilGNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR*
Ga0075425_10095224823300006854Populus RhizosphereYPANGFPTDKPRPQLQVKNLTGFSQGRGTPIGSVNDTQLWGADFGVLR*
Ga0075435_10143646723300007076Populus RhizosphereTYPKNGYPTDRPRPQLLTQNLTGFSHGIGSPIGSVQDNQLWGADFGVLR*
Ga0075435_10192731723300007076Populus RhizosphereRPRPQLFVNNLTGFSHGLGTPIGSVSDFQLWGANFGVLR*
Ga0099827_1114516113300009090Vadose Zone SoilPRPQIRVNNLTGFSNGFGPIVGAVNSNQLWSFIFGVLK*
Ga0066709_10318800413300009137Grasslands SoilKNGYPTDRPRPQLLTQNLTGFSQGHYPLGTPIGNVNDNQLWGADWGILR*
Ga0105241_1234371113300009174Corn RhizosphereTDRPRPQLFVNNLTGFSHGIGTPIGSVNDTQLWGADFGVLR*
Ga0134067_1031844523300010321Grasslands SoilFPTDKPRPQLQVRNLTGFSNGNGGPVLGSVSSNQLWGATFGVLH*
Ga0126370_1162057123300010358Tropical Forest SoilPRPQLRVANLTGFSNGIGAVVGTVIDTQLWGADFGVLK*
Ga0126379_1185172413300010366Tropical Forest SoilGFPTDKPRPQLQFKNLTGFSNGRGTPIGSVQDIQLWGADFGVLR*
Ga0134128_1251596413300010373Terrestrial SoilRPQLQVRNLTGFSNGIGRVVGTVIDTQLWGADFGVGR*
Ga0126381_10228092223300010376Tropical Forest SoilMSGVTDAPRPQLLVQNLTGFSHGFGSPIGSVEDNQLWGAAFGILQ*
Ga0126381_10296670623300010376Tropical Forest SoilDRPRPQLFVNNLTGFSHGIGTPIGSVSDFQLWGENDGVLR*
Ga0136449_10018749573300010379Peatlands SoilPRPQLTVTNLTGFSNGFGGIELGTVTSNQLWAANFGVLH*
Ga0136449_10342799613300010379Peatlands SoilGNPTDVPRPQLFVSNLTGFSNGFGPIVGTVNENQLWSAVPGVLGP*
Ga0136449_10392656523300010379Peatlands SoilPRPQLVVLNLTGFSNGISGPQVGTISSNQLWGARFGVLP*
Ga0134126_1083166113300010396Terrestrial SoilPRPQLLVQNLTGFTQGHFPHGTPIGNVDDNQLWGADWGILR*
Ga0134126_1215566823300010396Terrestrial SoilPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0126383_1251376613300010398Tropical Forest SoilNGFPTDTPRPQVFVQNLTGFSHGFGSPIGSVQDNQLWGADFGVLR*
Ga0134127_1171659713300010399Terrestrial SoilRPQLLVQNLTGFTQGHFPHGTPIGNVNDNQLWGADWGILR*
Ga0126350_1214074013300010880Boreal Forest SoilPFVLTYPGNGFPTDKPRPQLFVNNLTGFSSGRGLQVGSVNDTQLWGADSGVLR*
Ga0137392_1044948313300011269Vadose Zone SoilGFPTDIPRPQLQVRNLTGFSNGFGPIVGTVIDTQLWGADFGVIK*
Ga0137391_1018712213300011270Vadose Zone SoilGFPTDIPRPQLQVRNLTGFSNGIGPIVGTVPDTQLWGADFGVIK*
Ga0137379_1009853953300012209Vadose Zone SoilDKPRPQLFVTNLTGFSHGIGTPIGSVSDFQLWGADFGVLR*
Ga0137386_1101151213300012351Vadose Zone SoilIPRPQLQVRNLTGFSNGFGPIVGTVPDTQLWGADFGVIK*
Ga0137366_1107468913300012354Vadose Zone SoilPFVLTYPANGFPTDRPRPQLFVNNLTGFSHGIGTPIGSVNDTQLWGANFGVLR*
Ga0137413_1123443313300012924Vadose Zone SoilFPTDKPRPQLFVNNLTGFSHGIGQEIGSVNDTQLWGADFGVLR*
Ga0164299_1029672833300012958SoilMSIKSKVFVQNLTGFSHGPGDPIGSVQDNQLWGADWGVLR*
Ga0164301_1111390623300012960SoilGFPTDKPRPQLFVSNLDGFQTTIGTPIGSVNDFQLWGADFGVLR*
Ga0164309_1061076713300012984SoilPFVMTYPANGFPTDKPRPQIFVNNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0157369_1193560323300013105Corn RhizosphereQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR*
Ga0163163_1078247313300014325Switchgrass RhizospherePHVMTYPSNGFPTDRPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0182008_1075784423300014497RhizosphereGNGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVNDTQLWGADFGVLR*
Ga0173480_1074723623300015200SoilNGYPTDRPRPQLFTQNLTGFSHGIGSPIGSVQDNQLWGADWGVLR*
Ga0137403_1093868613300015264Vadose Zone SoilRPQLFVTNLTGFSHGIGTPIGSVDDTQLWGADFGVLR*
Ga0132256_10124529913300015372Arabidopsis RhizosphereDKPRPQLQVRNLTGFSNGFGPIVGTVIDTQLWGADFGVIR*
Ga0182038_1049145013300016445SoilRPRPQIQVRNLTGFSNGFGPIIGTVIDTQLWGADFGVLR
Ga0187812_102026213300017821Freshwater SedimentLSYPANGFPTDKPRPQLVVLNLTGFSNGTGGPEVNTVNSSQLWGATFGVLP
Ga0187855_1032002523300018038PeatlandVLTYPKNGYPTDRPRPQLFTQNLTGFSRGFGSPIGSVQDNQLWGADFGVLG
Ga0210408_1074813423300021178SoilGFPTDKPRPQLFTANLTGFSHGIGTPIGSVNDTQLWGANFGVLR
Ga0213881_1022273123300021374Exposed RockFPTDRPRPQLTVKNLTGFSHGIGTPIGSVQDIQLWGADIGVLR
Ga0213878_1024478913300021444Bulk SoilKNGFPTDTPRPQLLVQNLTGFSNGFGPIVGTVPDYQLWGAVFGVLK
Ga0210392_1133012113300021475SoilFVLSYPANGFPTDKPRPQLQTKNLTGFTQGRGTQVGSVDDTQLWGADFGVLR
Ga0126371_1163678513300021560Tropical Forest SoilPFVLTYPSNGFPTDRPRPQLFVNNLTGFSHGIGTPIGSVSDFQLWGANFGVLR
Ga0126371_1234167613300021560Tropical Forest SoilVLTYPGNGFPTDKPRPQLFVNNLTGFSHGIGTPIGSVDDTQLWGADFGVLR
Ga0126371_1247498313300021560Tropical Forest SoilFPTDRPRPQLFVNNLTGFSHGIGTPIGSVNDTQLWGANFGVLR
Ga0207692_1002907043300025898Corn, Switchgrass And Miscanthus RhizosphereNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR
Ga0207693_1037972823300025915Corn, Switchgrass And Miscanthus RhizosphereFSHPHVLSYPGNGFPTDKPRPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADVGVLR
Ga0207663_1003078613300025916Corn, Switchgrass And Miscanthus RhizosphereTDKPRPQIQVKNLTGFSQGRGTPIGSVNDTQLWGADFGVLR
Ga0207700_1056106013300025928Corn, Switchgrass And Miscanthus RhizosphereTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADFGVLR
Ga0207700_1178627113300025928Corn, Switchgrass And Miscanthus RhizosphereYPGGGFPTDKPRPQLFVTNLTGFASGVGSPIGSVDDTQLWGADFGVLR
Ga0207664_1020124333300025929Agricultural SoilSHPFVLSYPANGFPTDKPRPQLQVKNLTGFSHGIGTPIGSVDDTQLWGADFGVLR
Ga0207664_1200784613300025929Agricultural SoilGFPTNKPRPQLFVTNLTGFSHGIGTPIGSVDDTQLWGADFGNLR
Ga0207702_1222966023300026078Corn RhizospherePGNGFPTDKPRPQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR
Ga0207675_10035950433300026118Switchgrass RhizosphereGFPTDKPRPQLQVRNLTGFSNGIGRVVGTVIDTQLWGANFGVGR
Ga0209648_10005240103300026551Grasslands SoilRPQLQVRNLTGFSNGIGPIVGTVPDTQEWGANFGVLK
Ga0209178_137894713300027725Agricultural SoilFPTDRPRPQLLVQNLTGFTQGHFPLGTPIGNVNDNQLWGADWGILR
Ga0209177_1003955723300027775Agricultural SoilGFPTDTPRPPVFVQNLTGFSHGFGSPIGSVQDNQLWGADFGVLR
Ga0209074_1015880523300027787Agricultural SoilQLQVKNLTGFSQGIGTPIGSVNDTQLWGADLGVLR
Ga0209590_1002292013300027882Vadose Zone SoilMTYPRNGYPTDRPRPQIRVNNLTGFSNGFGPIVGSVNSNQLWGFRFGVLK
Ga0307313_1001563533300028715SoilGFPTDKPRPQLQTRNLTGFSNGFGPTVGTVIDTQLWGANFGVLK
Ga0318571_1000266453300031549SoilHVMTYPANGYPTDRPRPQIQVRNLTGFSNGFGPIIGTVIDTQLWGADFGVLR
Ga0318496_1047737913300031713SoilHVMTYPANGYPTDRPRPQIQVRNLTGFSNGFGPIIGTVIDTQLWGATFGVIRG
Ga0318497_1015442123300031805SoilVMTYPANGYPTDRPRPQIQVRNLTGFSNGFGPIIGTVIDTQLWGATFGVIRG
Ga0306924_1061120813300032076SoilQIQVRNLTGFSNGFGPIIGTVIDTQLWGATFGVIRG
Ga0307470_1040795323300032174Hardwood Forest SoilFVLTYPANGFPTDKPRPQLQTRNLTGFSNGIGKVVGTVIDTQLWGANFGVGR
Ga0307470_1126865113300032174Hardwood Forest SoilGFPTDKPRPQLFVTNLTGFSHGIGTPIGSVDDTQLWGADFGNLR
Ga0335080_1006506143300032828SoilTPRPQVLVQNLTGFSHGWGSPIGSVQDNQLWGADWGVLR
Ga0335077_1157645313300033158SoilYPANGYPTDKPRPQLRVANLTGFSNGIGRVVGTVIDTQLWGARFGVGR
Ga0370548_036266_3_1133300034644SoilPQLFVNTLTGFTAGHGKQIGSVNDTQLWGADFGVLR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.