NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105828

Metagenome / Metatranscriptome Family F105828

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105828
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 40 residues
Representative Sequence VEYILLVALIALAVIAAVVFLKNQVNSKFNDAGSKLSSSGS
Number of Associated Samples 88
Number of Associated Scaffolds 98

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.00 %
% of genes near scaffold ends (potentially truncated) 87.00 %
% of genes from short scaffolds (< 2000 bps) 91.00 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds
(14.000 % of family members)
Environment Ontology (ENVO) Unclassified
(23.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.07%    β-sheet: 0.00%    Coil/Unstructured: 44.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 98 Family Scaffolds
PF04964Flp_Fap 55.10
PF03449GreA_GreB_N 3.06
PF00482T2SSF 3.06
PF11799IMS_C 2.04
PF00005ABC_tran 2.04
PF03492Methyltransf_7 1.02
PF16976RcpC 1.02
PF05872HerA_C 1.02
PF13508Acetyltransf_7 1.02
PF00437T2SSE 1.02
PF05534HicB 1.02
PF13577SnoaL_4 1.02
PF01527HTH_Tnp_1 1.02
PF01121CoaE 1.02
PF13523Acetyltransf_8 1.02
PF08281Sigma70_r4_2 1.02
PF13350Y_phosphatase3 1.02
PF00903Glyoxalase 1.02
PF01243Putative_PNPOx 1.02

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 98 Family Scaffolds
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 55.10
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 3.06
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 1.02
COG0433Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domainsReplication, recombination and repair [L] 1.02
COG1598Antitoxin component HicB of the HicAB toxin-antitoxin systemDefense mechanisms [V] 1.02
COG4226Predicted nuclease of the RNAse H fold, HicB familyGeneral function prediction only [R] 1.02

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.00 %
UnclassifiedrootN/A36.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2305570All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300005093|Ga0062594_101338174All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005329|Ga0070683_102220678All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005366|Ga0070659_101096191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus siccatus702Open in IMG/M
3300005367|Ga0070667_102065397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300005441|Ga0070700_101725171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300005466|Ga0070685_10951419Not Available642Open in IMG/M
3300005535|Ga0070684_101713611All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005536|Ga0070697_102042244All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005617|Ga0068859_102326459All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005718|Ga0068866_10526809All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005764|Ga0066903_103143418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia893Open in IMG/M
3300006028|Ga0070717_10790594All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300006046|Ga0066652_101653023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300006047|Ga0075024_100471166All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006048|Ga0075363_100522635All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300006050|Ga0075028_100247277All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300006052|Ga0075029_100032765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2959Open in IMG/M
3300006059|Ga0075017_100423387All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300006102|Ga0075015_100119236All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300006102|Ga0075015_100471004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300006162|Ga0075030_100658456All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006172|Ga0075018_10057261All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300006174|Ga0075014_100423495All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300006354|Ga0075021_10649570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.675Open in IMG/M
3300006354|Ga0075021_10994931All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006755|Ga0079222_12375272All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006846|Ga0075430_100079140All Organisms → cellular organisms → Bacteria2755Open in IMG/M
3300006852|Ga0075433_11611511Not Available560Open in IMG/M
3300006853|Ga0075420_100149284All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300006904|Ga0075424_101439107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300007214|Ga0103959_1092947All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300007769|Ga0102952_1315181Not Available513Open in IMG/M
3300009093|Ga0105240_10904195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium949Open in IMG/M
3300009094|Ga0111539_10243324Not Available2095Open in IMG/M
3300009162|Ga0075423_11726272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300010047|Ga0126382_11229469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300010166|Ga0126306_11241682Not Available613Open in IMG/M
3300010166|Ga0126306_11241682Not Available613Open in IMG/M
3300010379|Ga0136449_100545660Not Available1996Open in IMG/M
3300010379|Ga0136449_100665662Not Available1755Open in IMG/M
3300010379|Ga0136449_100754578Not Available1619Open in IMG/M
3300010398|Ga0126383_13103499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300010399|Ga0134127_12505172Not Available596Open in IMG/M
3300012206|Ga0137380_11466686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012212|Ga0150985_118176108Not Available629Open in IMG/M
3300012931|Ga0153915_11138812Not Available911Open in IMG/M
3300012951|Ga0164300_10054872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1590Open in IMG/M
3300012958|Ga0164299_10244404Not Available1068Open in IMG/M
3300012960|Ga0164301_10675839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300013296|Ga0157374_12220342Not Available576Open in IMG/M
3300013297|Ga0157378_10474340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1246Open in IMG/M
3300014295|Ga0075305_1050065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M
3300014322|Ga0075355_1094706Not Available734Open in IMG/M
3300014501|Ga0182024_12206148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura602Open in IMG/M
3300014745|Ga0157377_10417165Not Available918Open in IMG/M
3300014968|Ga0157379_11124346Not Available753Open in IMG/M
3300015242|Ga0137412_10989068Not Available603Open in IMG/M
3300015372|Ga0132256_101651946Not Available750Open in IMG/M
3300015374|Ga0132255_100143913All Organisms → cellular organisms → Bacteria3314Open in IMG/M
3300015374|Ga0132255_103604626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300018072|Ga0184635_10379273Not Available538Open in IMG/M
3300018469|Ga0190270_12175130Not Available615Open in IMG/M
3300018476|Ga0190274_11804112Not Available706Open in IMG/M
3300018481|Ga0190271_10938330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300018481|Ga0190271_10938330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300020220|Ga0194119_10586649Not Available688Open in IMG/M
3300025721|Ga0209587_1042075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1302Open in IMG/M
3300025813|Ga0210064_1083865Not Available781Open in IMG/M
3300025914|Ga0207671_11371910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300025941|Ga0207711_11245180Not Available686Open in IMG/M
3300025961|Ga0207712_11867772Not Available538Open in IMG/M
3300026041|Ga0207639_11486932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300026067|Ga0207678_11744435Not Available546Open in IMG/M
3300027911|Ga0209698_10507202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300027915|Ga0209069_10118452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300027915|Ga0209069_10239183Not Available940Open in IMG/M
3300028679|Ga0302169_10105246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300028732|Ga0302264_1047781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300028732|Ga0302264_1086914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300028733|Ga0302261_1020520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1526Open in IMG/M
3300028782|Ga0307306_10233712Not Available534Open in IMG/M
3300029980|Ga0302298_10180604Not Available686Open in IMG/M
3300029990|Ga0311336_11179629All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300029990|Ga0311336_11691055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300030002|Ga0311350_10116233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2354Open in IMG/M
3300030010|Ga0302299_10183684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300030019|Ga0311348_11436327Not Available513Open in IMG/M
3300031228|Ga0299914_10803133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300031251|Ga0265327_10276323Not Available743Open in IMG/M
3300031722|Ga0311351_10496707Not Available926Open in IMG/M
3300031918|Ga0311367_12106513Not Available542Open in IMG/M
3300032160|Ga0311301_10104027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5520Open in IMG/M
3300032160|Ga0311301_10742973Not Available1365Open in IMG/M
3300032160|Ga0311301_11523383Not Available821Open in IMG/M
3300032164|Ga0315283_10816406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura998Open in IMG/M
3300032397|Ga0315287_10061880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC262074147Open in IMG/M
3300032516|Ga0315273_10275627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2287Open in IMG/M
3300032829|Ga0335070_11533193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300034676|Ga0314801_204313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds14.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen12.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007769Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300025721Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes)EnvironmentalOpen in IMG/M
3300025813Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028732Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4EnvironmentalOpen in IMG/M
3300028733Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_230557033300000033SoilTERGASMGEYILLVALIALAVIAAVVFLRGQMSNKFDEAGSTVSRLPNP*
Ga0062594_10133817413300005093SoilGASLVEYILLVALIALAVIAAVIFLRNQVSNKFSEAGSRLSSGN*
Ga0070683_10222067813300005329Corn RhizosphereVEYILLVALIALAVIAAVIFLRSQVQDKFSEAGSKLSTNG*
Ga0070659_10109619113300005366Corn RhizosphereVEYILLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS*
Ga0070667_10206539723300005367Switchgrass RhizosphereVEYILLVALIALAVVAAVVFMRNQISTKFDYAGSKISATPNG*
Ga0070700_10172517123300005441Corn, Switchgrass And Miscanthus RhizosphereVEYILLVALIALAVIAAVVFMRNQMQERFSYAGSKISATPNG*
Ga0070685_1095141923300005466Switchgrass RhizosphereASMVEYILLVALIALAVLAAVSFLGKGMTDKFNTEGSQISSAGS*
Ga0070684_10171361123300005535Corn RhizosphereVEYILLVALIALAVIAAVIFVRTQAQSKFSDAGSKLSNNG*
Ga0070697_10204224413300005536Corn, Switchgrass And Miscanthus RhizosphereEYILLVALIALAVIAAVVFLRGQVSSKFNDAGSHLSSGN*
Ga0068859_10232645923300005617Switchgrass RhizosphereGASLVEYILLVALIALAVIAAVIFLRNQVSTKFNDAGSRLSTGN*
Ga0068866_1052680933300005718Miscanthus RhizosphereMVEYILLVALIALAVIAAVVFLRSQVQDKFSDAGSKLSNSGS*
Ga0066903_10314341813300005764Tropical Forest SoilSLVEYILLVALIALAVIAAVIFMRDQVSSKFDYAGSKISATPKG*
Ga0070717_1079059423300006028Corn, Switchgrass And Miscanthus RhizosphereVEYILLVALIALAVIAAVSFLGGTMTNKFNNEGSQLSSAGS*
Ga0066652_10165302323300006046SoilVALIALAVIAAVVFLKDQVNSKFNDAGSKLSSSGS*
Ga0075024_10047116623300006047WatershedsMVEYILLVALIALAVIAAVSFLGNQINGTYNREGSSISSAGT*
Ga0075363_10052263523300006048Populus EndosphereYILLVALIALAVIAAVTFLGGTMTSKFNQEGSQISSAGT*
Ga0075028_10024727713300006050WatershedsLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS*
Ga0075029_10003276513300006052WatershedsMVEYILLVALIALAVLAAVSFLGGQVTGKFNTEGSQISSAGG*
Ga0075017_10042338723300006059WatershedsLLVALIALAVIAAVVFLKNQVNAKFNDAGSKLSSSGS*
Ga0075015_10011923623300006102WatershedsEYILLVALIALAVIAAVVFLKNQVNAKFNDAGSKLSSSGS*
Ga0075015_10047100423300006102WatershedsLLVALIALAVIAAVLFLHDQISAKFNQSGSSLSSAGS*
Ga0075030_10065845633300006162WatershedsEYILLVALIALAVIAAVVFLKNQVQGKFNQAGSSLSSSGS*
Ga0075018_1005726143300006172WatershedsEYILLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS*
Ga0075014_10042349523300006174WatershedsVEYILLVALIALAVIAAVVFLKNQVQGKFNQAGSSLSSSGS*
Ga0075021_1064957033300006354WatershedsVALIALAVIAAVVFLKNQVNAKFNDAGSKLSSSGS*
Ga0075021_1099493123300006354WatershedsVEYILLVALIALAVIAAVVFLRGQVSSKFDQTGSTLSSN*
Ga0079222_1237527223300006755Agricultural SoilLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSAGS*
Ga0075430_10007914013300006846Populus RhizosphereYILLVALIALAVIAAVVFLRGEVETKFSDAGSSVSNAPNAS*
Ga0075433_1161151123300006852Populus RhizosphereLVALIALAVIAAVVFLKDQVNNKFNDAGSKLSSSGS*
Ga0075420_10014928413300006853Populus RhizosphereLVALIALAVIAAVVFLRGEVQDKFSDAGSKLSNAPNAS*
Ga0075424_10143910713300006904Populus RhizosphereLLVALIALAVIAAVVFLKDQVNNKFNDAGSKLSSSGS*
Ga0103959_109294723300007214Freshwater LakeVLLVALIALAVIAAVVFLRGQVSDKFNDAGTQIQNNGA*
Ga0102952_131518113300007769SoilMVAYILLVALIALAVLAAVSFLGSQMTGKFNTEGSIISSAGS*
Ga0105240_1090419513300009093Corn RhizosphereMVEYILLVALICLAVLAAVTFLSRTMNNKFNTEGSQISSA
Ga0111539_1024332433300009094Populus RhizosphereLVEYILLVALIALAVIAAVIFLRSQVQSKFSEAGSKLSTNG*
Ga0075423_1172627223300009162Populus RhizosphereMVEYILLVALIALAVLAAVSFLGGQMTGKFNTEGSQISSAGS*
Ga0126382_1122946913300010047Tropical Forest SoilLVEYILLVALIALAVIAAVVFLRGEVNDKFSETGSKLSSNGN*
Ga0126306_1124168213300010166Serpentine SoilLVALIALAVIAAVVFLKNQVNNKFNDAGSKLSSSGS*
Ga0126306_1124168223300010166Serpentine SoilMVEYILLVALIALAVLAAVSFLGKQTTDTFNREGSVISSAGG*
Ga0136449_10054566033300010379Peatlands SoilLVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS*
Ga0136449_10066566233300010379Peatlands SoilLVEYILLVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS*
Ga0136449_10075457833300010379Peatlands SoilVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS*
Ga0126383_1310349913300010398Tropical Forest SoilLVEYILLVALIALAVIAAVIFLRNGVSSKFNEAGSKLSSNG*
Ga0134127_1250517213300010399Terrestrial SoilGANLVEYILLVALIAQAVIAAVIFLRGQVGEKFSETGSRLSSGS*
Ga0137380_1146668623300012206Vadose Zone SoilMVEYILLVALIALAVIAAVVFLRGQVSSKFNQAGSKISSNG*
Ga0150985_11817610813300012212Avena Fatua RhizosphereMVEYILLVALIALAVIAAVSFLGKGMTDKFNTEGSQLSSAGS*
Ga0153915_1113881223300012931Freshwater WetlandsMVEYILLVALIALAVIGAVTFLSGQMNNSFNHEGSSLSSIGS*
Ga0164300_1005487243300012951SoilMVEYILLVALIALAVIAAVSFLGKGMTDKFNTEGSQISSAGS*
Ga0164299_1024440443300012958SoilLVALIALAVIAAVIFLRNQVSNKFSEAGSRLSSGN*
Ga0164301_1067583913300012960SoilLVALIALAVIAAVVFMRNQMEDRFSYAGSKISATPNG*
Ga0157374_1222034223300013296Miscanthus RhizosphereMVEYILLVALIALAVLAAVSILGRGMTDKFNTEGSQLSSAGS*
Ga0157378_1047434013300013297Miscanthus RhizosphereLVEYILLVALIALAVIAAVVFMRNQMQERFSYAGSKISATPNG*
Ga0075305_105006533300014295Natural And Restored WetlandsVALIALAVIAAVVFLRGQVQDKFSDAGTKLSEAGS*
Ga0075355_109470633300014322Natural And Restored WetlandsGANLVEYILLVALIALAVIAAVIFLRGQVSDKFNETGSKLSSNGA*
Ga0182024_1220614813300014501PermafrostNLVEYLLLVGLIAIAVMGAVAFLGGQVTGLFNQAGSQVSRAPAP*
Ga0157377_1041716533300014745Miscanthus RhizosphereVALIALAVIAAVIFLRGQVQSKFSEAGSKLSSNG*
Ga0157379_1112434613300014968Switchgrass RhizosphereLVALIALAVIAAVVFLRGQVQDKFSDAGSKLSNSGT*
Ga0137412_1098906823300015242Vadose Zone SoilMKKIAALIALAVIAAVVFLKNQVNSKFNQSGSSLSSAG*
Ga0132256_10165194613300015372Arabidopsis RhizosphereILLVALIALAVIAAVVFLKDQVNSKFNDAGSKLSSSG*
Ga0132255_10014391333300015374Arabidopsis RhizosphereMVEYILLVALIALAVIAAVVFLRGQMSNKFDEAGSTVSRLPNP*
Ga0132255_10360462613300015374Arabidopsis RhizosphereILLVALIALAVIAAVIFLRNQVSSKFSEAGSKLSSNG*
Ga0184635_1037927323300018072Groundwater SedimentEYILLVALIALAVIGAVVFMRNQVSTKFDFAGSKISATPNG
Ga0190270_1217513013300018469SoilLLVALIALAVIAAVVFLKDQVNSKFNDAGSKLSSSGS
Ga0190274_1180411223300018476SoilLIALAVIAAVVFLRTQVQSKFSDAGSKLSNAPNAS
Ga0190271_1093833013300018481SoilVEYILLVALIALAVIAAVIFLRGQVSDKFNETGSKLSSNGN
Ga0190271_1093833043300018481SoilEYILLVALIALAVIAAVIFLRGQVSDKFNETGSKLSNNGN
Ga0194119_1058664913300020220Freshwater LakeVEYILLVALIALAVIAAVIFLRGQVSNKFNETGSKLSNNGN
Ga0209587_104207543300025721Arctic Peat SoilEYILLIALIAILVIAAVAFLRGRVQNKFSEAGNSLA
Ga0210064_108386513300025813Natural And Restored WetlandsILLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS
Ga0207671_1137191023300025914Corn RhizosphereLVALIALAVIAAVVFLKNQVNSKFNDAGSKLSSSGS
Ga0207711_1124518013300025941Switchgrass RhizosphereVEYILLVALIALAVIAAVVFMRNQMQERFSYAGSKISATPNG
Ga0207712_1186777223300025961Switchgrass RhizosphereASLVEYILLVALIALAVIAAVIFLRGQVQSKFSEAGSKLSSNG
Ga0207639_1148693213300026041Corn RhizosphereEYILLVALIALAVIAAVVFLRGQVQGKFNDAGSKISSNGT
Ga0207678_1174443513300026067Corn RhizosphereEYILLVALIALAVIAAVIFMRSQVQSKFSEAGSKLSTNG
Ga0209698_1050720213300027911WatershedsEYILLVALIALAVIAAVVFLKNQVQGKFNQAGSSLSSSGS
Ga0209069_1011845213300027915WatershedsASMVEYILLVALIALAVIAAVSFLGNQINGTYNREGSSISSAGT
Ga0209069_1023918323300027915WatershedsEYILLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS
Ga0302169_1010524613300028679FenEYILLISLIALAVIGAVMFMRGQIVDKMNYAGSKISNTPNP
Ga0302264_104778113300028732FenLLVALIALAVLAAVSFLGGQMTSKFNTEGSQISSAGG
Ga0302264_108691423300028732FenLVALIALAVIAAVVFLEGQVQGKFGDAGSKISSSGS
Ga0302261_102052013300028733FenMVEYILLVALIALAVLAAVSFLGGQMTSKFNTEGSQISSAGG
Ga0307306_1023371213300028782SoilVEYILLVALIALAVIAAVVFLKNQVNSKFNDAGSKLSSSGS
Ga0302298_1018060413300029980FenQGANLVEYILLVSLIALAVIGAVMFMRGQVSDKFNYAGSKISNTPNP
Ga0311336_1117962913300029990FenLLIALIALAVIGAVVFLRGQLVDKFDYTGSKISNTPNP
Ga0311336_1169105513300029990FenMVEYILLVALIALAVLAAVSFLGGQMTSKFNTEGSQ
Ga0311350_1011623343300030002FenLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS
Ga0302299_1018368433300030010FenVEYILLVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS
Ga0311348_1143632723300030019FenANLVEYILLVALIALAVIAAVIFLRGQVSDKFNETGSKLSNNGN
Ga0299914_1080313313300031228SoilLVALIALAVIAAVVFLRGQVQTKFSDAGSQLSSNGS
Ga0265327_1027632323300031251RhizosphereLVALIALAVLAAVSFLGGQMNGKFNTDGSIISSAGG
Ga0311351_1049670713300031722FenQGANLVEYILLVALIALAVIAAVIFLRGQVSAKFNETGSKLSNGG
Ga0311367_1210651333300031918FenVALIALAVIAAVVFLKDQVNGKFNDAGSKLSSSGS
Ga0311301_1010402773300032160Peatlands SoilLVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS
Ga0311301_1074297313300032160Peatlands SoilVEYILLVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS
Ga0311301_1152338323300032160Peatlands SoilILLVALIALAVIAAVVFLRGQVNSQFNNAGSHLSQGS
Ga0315283_1081640613300032164SedimentALIALAVIAAVTFLSGQIGDKFSDTGSKLSNAPTAPSAT
Ga0315287_1006188013300032397SedimentYILLVALIALAVIAAVTFLSGQIGDKFSDTGSKLSNAPTAPSAT
Ga0315273_1027562743300032516SedimentLIALAVIAAVTFLSGQIGDKFSDTGTKLSNAPTTP
Ga0335070_1153319323300032829SoilANLVEYILLVALIALAVIAAVVFLRGQVSSKFDTTGSKLSAG
Ga0314801_204313_4_1323300034676SoilMVEYILLVALIALAVIAAVVFLRGQVQDKFSDAGSKLSNSGT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.