NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105955

Metagenome / Metatranscriptome Family F105955

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105955
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLG
Number of Associated Samples 83
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(42.000 % of family members)
Environment Ontology (ENVO) Unclassified
(52.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.92%    β-sheet: 12.50%    Coil/Unstructured: 39.58%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00497SBP_bac_3 62.00
PF00583Acetyltransf_1 3.00
PF02798GST_N 2.00
PF13551HTH_29 1.00
PF01381HTH_3 1.00
PF00175NAD_binding_1 1.00
PF13424TPR_12 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.00 %
UnclassifiedrootN/A7.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005332|Ga0066388_104477056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017712Open in IMG/M
3300005332|Ga0066388_108238839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017520Open in IMG/M
3300005363|Ga0008090_15684165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017551Open in IMG/M
3300005437|Ga0070710_10191380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171287Open in IMG/M
3300005445|Ga0070708_100973312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017796Open in IMG/M
3300005467|Ga0070706_101239857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017685Open in IMG/M
3300005559|Ga0066700_10975481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017559Open in IMG/M
3300005764|Ga0066903_102237045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171055Open in IMG/M
3300005764|Ga0066903_102755926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017953Open in IMG/M
3300006163|Ga0070715_10827992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017564Open in IMG/M
3300006176|Ga0070765_100807799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017886Open in IMG/M
3300006794|Ga0066658_10779436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017537Open in IMG/M
3300006806|Ga0079220_10867452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017695Open in IMG/M
3300007255|Ga0099791_10264382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017817Open in IMG/M
3300009089|Ga0099828_11350362All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300010046|Ga0126384_11664506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017602Open in IMG/M
3300010047|Ga0126382_10355565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300010048|Ga0126373_11011100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017897Open in IMG/M
3300010048|Ga0126373_11815259Not Available673Open in IMG/M
3300010048|Ga0126373_12248526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017606Open in IMG/M
3300010154|Ga0127503_10078289Not Available585Open in IMG/M
3300010358|Ga0126370_12398142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300010359|Ga0126376_11850124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria642Open in IMG/M
3300010362|Ga0126377_10778599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171014Open in IMG/M
3300010362|Ga0126377_12412773Not Available602Open in IMG/M
3300011270|Ga0137391_10924813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017713Open in IMG/M
3300012198|Ga0137364_11466872Not Available503Open in IMG/M
3300012200|Ga0137382_10800227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300012202|Ga0137363_11083360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
3300012351|Ga0137386_10410642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300012359|Ga0137385_11179738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300012362|Ga0137361_11799281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300012363|Ga0137390_11356394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300012948|Ga0126375_11015402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales676Open in IMG/M
3300012961|Ga0164302_10872101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300016270|Ga0182036_10247004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1334Open in IMG/M
3300016294|Ga0182041_10057051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2676Open in IMG/M
3300016371|Ga0182034_10899046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales761Open in IMG/M
3300016422|Ga0182039_11085806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria720Open in IMG/M
3300016445|Ga0182038_10950613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales759Open in IMG/M
3300018482|Ga0066669_12095201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300020581|Ga0210399_10114498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2212Open in IMG/M
3300021384|Ga0213876_10744083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300021478|Ga0210402_10469960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1168Open in IMG/M
3300022527|Ga0242664_1092176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales612Open in IMG/M
3300025939|Ga0207665_10724766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017783Open in IMG/M
3300026508|Ga0257161_1065320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300027071|Ga0209214_1045335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium593Open in IMG/M
3300027109|Ga0208603_1046445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017664Open in IMG/M
3300027765|Ga0209073_10364458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300028047|Ga0209526_10137152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171716Open in IMG/M
3300031057|Ga0170834_105254839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300031474|Ga0170818_112811325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300031544|Ga0318534_10707509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300031545|Ga0318541_10821994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300031546|Ga0318538_10285469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017888Open in IMG/M
3300031561|Ga0318528_10451476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017690Open in IMG/M
3300031572|Ga0318515_10259800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria931Open in IMG/M
3300031572|Ga0318515_10423317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017712Open in IMG/M
3300031681|Ga0318572_10099263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171641Open in IMG/M
3300031713|Ga0318496_10353850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017811Open in IMG/M
3300031713|Ga0318496_10585053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017617Open in IMG/M
3300031719|Ga0306917_10966870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017665Open in IMG/M
3300031719|Ga0306917_11480801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300031724|Ga0318500_10271226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017827Open in IMG/M
3300031724|Ga0318500_10629214Not Available545Open in IMG/M
3300031736|Ga0318501_10127522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171293Open in IMG/M
3300031736|Ga0318501_10184137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171087Open in IMG/M
3300031744|Ga0306918_10912840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017684Open in IMG/M
3300031763|Ga0318537_10140923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300031771|Ga0318546_10133000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171663Open in IMG/M
3300031795|Ga0318557_10601699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300031832|Ga0318499_10074442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1294Open in IMG/M
3300031833|Ga0310917_11130364All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300031835|Ga0318517_10490800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300031845|Ga0318511_10337368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017685Open in IMG/M
3300031846|Ga0318512_10025959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2467Open in IMG/M
3300031879|Ga0306919_10152877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171684Open in IMG/M
3300031890|Ga0306925_10080253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3447Open in IMG/M
3300031890|Ga0306925_11971272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017552Open in IMG/M
3300031894|Ga0318522_10027019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1913Open in IMG/M
3300031910|Ga0306923_12383901Not Available525Open in IMG/M
3300031941|Ga0310912_10216198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171468Open in IMG/M
3300031941|Ga0310912_10722739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017771Open in IMG/M
3300031942|Ga0310916_10010393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6191Open in IMG/M
3300031945|Ga0310913_10007470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6385Open in IMG/M
3300031945|Ga0310913_11134559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300031946|Ga0310910_10107847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2077Open in IMG/M
3300031954|Ga0306926_10032117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6168Open in IMG/M
3300031954|Ga0306926_10492587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1507Open in IMG/M
3300031981|Ga0318531_10180325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017950Open in IMG/M
3300031981|Ga0318531_10333606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017685Open in IMG/M
3300031981|Ga0318531_10598064Not Available500Open in IMG/M
3300032025|Ga0318507_10189176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017887Open in IMG/M
3300032035|Ga0310911_10345236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria859Open in IMG/M
3300032039|Ga0318559_10146777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00171070Open in IMG/M
3300032039|Ga0318559_10296703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300032060|Ga0318505_10309208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017746Open in IMG/M
3300032068|Ga0318553_10318024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017814Open in IMG/M
3300032091|Ga0318577_10386573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017669Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil42.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.00%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.00%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066388_10447705623300005332Tropical Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVVGGIVIGVFSGLALLSPKRWLTLPLEAYVEIF
Ga0066388_10823883913300005332Tropical Forest SoilMHYHWDLAMVLADTDRWLHGIGITLLYSVATVAGGIVIGVFCGLALLSPKRWV
Ga0008090_1568416513300005363Tropical Rainforest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLAMPLEAYVEI
Ga0070710_1019138023300005437Corn, Switchgrass And Miscanthus RhizosphereVGPPLPAALKDTQLHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLTLLGQKRWLTLPLEAYVEIF
Ga0070708_10097331223300005445Corn, Switchgrass And Miscanthus RhizosphereMHYHWDLAMVLADTDRWWHGISITLLYSVATVAGGILIGVFCGLALLGQKRWLTLP
Ga0070706_10123985713300005467Corn, Switchgrass And Miscanthus RhizosphereMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIIIGVFCGLALLGQKRWLTLPLEGYVE
Ga0066700_1097548123300005559SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQK
Ga0066903_10223704523300005764Tropical Forest SoilMHYHWDLAMVLADTDRWWQGIGITLLYSVATVAGGIVIGVF
Ga0066903_10275592613300005764Tropical Forest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVI
Ga0070715_1082799223300006163Corn, Switchgrass And Miscanthus RhizosphereMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLALLGQK
Ga0070765_10080779923300006176SoilVGPPLPAALKDTQLHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLTLLGQKRWLTLP
Ga0066658_1077943623300006794SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVSCGLALLGQKRWLTLPLEGYVEIF
Ga0079220_1086745223300006806Agricultural SoilMHYHWDLAMVLADTNRWWHGIGVTLLYSVATVAGGIVIGVFCGLALLSPKRWLTLPLEG
Ga0099791_1026438223300007255Vadose Zone SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLG
Ga0099828_1135036223300009089Vadose Zone SoilMHYHWDLAMVLADTDLWWHGIGVTLLYSVATVAGGIVIGVFCGLTLLSQRRWLTLPLE
Ga0126384_1166450623300010046Tropical Forest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLSPKRWLTMPLEAYVE
Ga0126382_1035556523300010047Tropical Forest SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVAGGI
Ga0126373_1101110013300010048Tropical Forest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLG
Ga0126373_1181525913300010048Tropical Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVACGIVIGIF
Ga0126373_1224852613300010048Tropical Forest SoilMNYHWDLAMVLADTDRWWHGIGVTLLYSVATVAGGIVIGVFCGLALLGQKRWLTLPLE
Ga0127503_1007828913300010154SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVVGGIVIGVIC
Ga0126370_1239814213300010358Tropical Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVVGGIVIGVFCGLALLSPKRWLTLPLEAYVEI
Ga0126376_1185012423300010359Tropical Forest SoilMHYHWDFAMVLADTDRWWHGVGITLLYSVATVTGGIVIGVFCGLALLGRKHWLTLPLEAYVE
Ga0126377_1077859923300010362Tropical Forest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLALPLE
Ga0126377_1241277313300010362Tropical Forest SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVVGGIVIGVI
Ga0137391_1092481323300011270Vadose Zone SoilMHYHWDLGMVLADTDLWWRGIGVTLLYSVATVAGGIVIGVFCGLTLLSQK
Ga0137364_1146687213300012198Vadose Zone SoilMHYHWDLAMVLADTDRWWHGIGVTLLYSVATVAGGIVIGVFCGL
Ga0137382_1080022723300012200Vadose Zone SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVSC
Ga0137363_1108336023300012202Vadose Zone SoilMHYHWDLAMVLADTDLWWRGIGITLLYSVATVAGGIVIGVFCGLTLLSQK
Ga0137386_1041064213300012351Vadose Zone SoilMHYHWDLAMVLADTDRWLYGIEITLLYSVATVVGGI
Ga0137385_1117973823300012359Vadose Zone SoilMHYHWDLAMVLADTDLWWRGIGITLLYSVATVAGGIVIGVFCGLTLLSQ
Ga0137361_1179928123300012362Vadose Zone SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWLTLPLE
Ga0137390_1135639423300012363Vadose Zone SoilMRAMHYHWDLAMVLADTDRWLYGIGITLVYSAATVIGGI
Ga0126375_1101540223300012948Tropical Forest SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLVMPLEAYIE
Ga0164302_1087210123300012961SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGG
Ga0182036_1024700413300016270SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGL
Ga0182041_1005705113300016294SoilMHYHWDLAMVLADTDRWWQGIGITLLYSVATVAGGIVIGVFCGLALL
Ga0182034_1089904623300016371SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAAGIVIGVFCGLALLGRRRWLAMPLEAY
Ga0182039_1108580613300016422SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVI
Ga0182038_1095061323300016445SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGR
Ga0066669_1209520113300018482Grasslands SoilMHYHWDLAMVLADTDRWLHGIAITLLYSVATVIGGIVIGVFCGLA
Ga0210399_1011449813300020581SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGIFCGLA
Ga0213876_1074408323300021384Plant RootsMHYHWDLAMVLADTDRWWHAIGITLLYSVATVAGGIVIGVFCGLALLSPK
Ga0210402_1046996013300021478SoilLHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWI
Ga0242664_109217623300022527SoilVGPPLPAALKDTQLHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLTLLGQKRWLTLPLEAYV
Ga0207665_1072476623300025939Corn, Switchgrass And Miscanthus RhizosphereMHYHWDLAMVLADTDRWWHGIGVTLLYSVATVAGGIVIGVFCGLTLLGQKRWL
Ga0257161_106532013300026508SoilMHYHWDLGMVLADTDLWWRGIGVTLLYSVATVAGG
Ga0209214_104533523300027071Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRW
Ga0208603_104644523300027109Forest SoilVGPPLPAALKDTPLHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGL
Ga0209073_1036445813300027765Agricultural SoilMHYHWDLAMVLADTNRWWHGIGVTLLYSVATVAGGIVIGVFCGLALLSPKRWLTLPLEGYVEIF
Ga0209526_1013715233300028047Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLSPKRWLTLPLEG
Ga0170834_10525483913300031057Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGI
Ga0170818_11281132523300031474Forest SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWLTLPLEGY
Ga0318534_1070750913300031544SoilMHYRWDLAMVLADTDRWWHGIGITLLYSLATVAGGIV
Ga0318541_1082199413300031545SoilMHYRWDLGMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLALPLEAYVEI
Ga0318538_1028546913300031546SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLALLGQKRWITLPLEGY
Ga0318528_1045147623300031561SoilMHYRWDLAMVLADTDRWWHGIGITVLYSVATVAGGIVIGVFCGLALLGRRRWLALPLEAY
Ga0318515_1025980033300031572SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILI
Ga0318515_1042331713300031572SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAAGIVIGVFC
Ga0318572_1009926313300031681SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQ
Ga0318496_1035385013300031713SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVACGIVIGVFCGLALLS
Ga0318496_1058505323300031713SoilMHYRWDLAMVLADTDRWWHGIGITLLYSLATVAGGIVIGVFCGLALLGRRRWLVLPLEAYVEI
Ga0306917_1096687023300031719SoilMHYRWDLAMVLADTDRWWHGIGITVLYSVATVAGGIVIGVFCGLALLGRR
Ga0306917_1148080113300031719SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLAMPLEAYVE
Ga0318500_1027122623300031724SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWLTAPLEAY
Ga0318500_1062921423300031724SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVVGGI
Ga0318501_1012752223300031736SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKR
Ga0318501_1018413713300031736SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWL
Ga0306918_1091284023300031744SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAAGIVIGVFCGLALLGR
Ga0318537_1014092323300031763SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVVGGIVIGVFCGLALLSPKR
Ga0318546_1013300013300031771SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWLTAP
Ga0318557_1060169913300031795SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRRWLAMPLEAYVEIFHC
Ga0318499_1007444223300031832SoilMVLADTDRWWQGIGITLLYSVATVAGGIVIGVFCGLALLSQK
Ga0310917_1113036413300031833SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVACGIVIGVFCGLALLSQRRWLTLP
Ga0318517_1049080023300031835SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVVGGIVIGVFCGLALLSPKRW
Ga0318511_1033736813300031845SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLAL
Ga0318512_1002595913300031846SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAAGIVIGVFCGL
Ga0306919_1015287733300031879SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWLTAPLEAYVEIF
Ga0306925_1008025313300031890SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIG
Ga0306925_1197127223300031890SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGL
Ga0318522_1002701943300031894SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGL
Ga0306923_1238390113300031910SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVVGGIV
Ga0310912_1021619813300031941SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVTTVAGGIVIGVFCG
Ga0310912_1072273923300031941SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRRR
Ga0310916_1001039313300031942SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGRHCSAKNA
Ga0310913_10007470113300031945SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLALLGQKRWITLP
Ga0310913_1113455923300031945SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIV
Ga0310910_1010784713300031946SoilMHYHWDLAMVLADTDRWWQGIGITLLYSVATVAGGIVIGVFCG
Ga0306926_10032117103300031954SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCG
Ga0306926_1049258733300031954SoilMHYHWDLSMVLADSSRWWSAAGVTLLYSFATVVGGIVIGVVCGL
Ga0318531_1018032533300031981SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLALLG
Ga0318531_1033360613300031981SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVACGIVIGVFCGLA
Ga0318531_1059806413300031981SoilMHYHWDLSMVLADSARWWSAAGVTLLYSFATVVGG
Ga0318507_1018917613300032025SoilMHYRWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGRR
Ga0310911_1034523613300032035SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVF
Ga0318559_1014677713300032039SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFC
Ga0318559_1029670323300032039SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGV
Ga0318505_1030920823300032060SoilMHYHWDLAMVLADTDRWWQGIGITLLYSVATVAGGIVIGVFCGLALLS
Ga0318553_1031802413300032068SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGILIGVFCGLA
Ga0318577_1038657323300032091SoilMHYHWDLAMVLADTDRWWHGIGITLLYSVATVAGGIVIGVFCGLALLGQKRWITLPLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.