Basic Information | |
---|---|
Family ID | F105966 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 49 residues |
Representative Sequence | MEKDGNRICDSCGQKIPSMSKLASKENGKDLCLACQIRLAQIEKGLRH |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.00 % |
% of genes near scaffold ends (potentially truncated) | 35.00 % |
% of genes from short scaffolds (< 2000 bps) | 86.00 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (9.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.79% β-sheet: 14.47% Coil/Unstructured: 69.74% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF02225 | PA | 19.00 |
PF04389 | Peptidase_M28 | 9.00 |
PF00873 | ACR_tran | 4.00 |
PF01039 | Carboxyl_trans | 3.00 |
PF00753 | Lactamase_B | 2.00 |
PF00583 | Acetyltransf_1 | 1.00 |
PF00903 | Glyoxalase | 1.00 |
PF02540 | NAD_synthase | 1.00 |
PF01435 | Peptidase_M48 | 1.00 |
PF01795 | Methyltransf_5 | 1.00 |
PF07676 | PD40 | 1.00 |
PF00691 | OmpA | 1.00 |
PF01610 | DDE_Tnp_ISL3 | 1.00 |
PF00069 | Pkinase | 1.00 |
PF14714 | KH_dom-like | 1.00 |
PF06108 | DUF952 | 1.00 |
PF02554 | CstA | 1.00 |
PF13442 | Cytochrome_CBB3 | 1.00 |
PF02899 | Phage_int_SAM_1 | 1.00 |
PF12867 | DinB_2 | 1.00 |
PF10518 | TAT_signal | 1.00 |
PF03793 | PASTA | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.00 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 3.00 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 3.00 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 3.00 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.00 |
COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG1966 | Carbon starvation protein CstA (peptide/pyruvate transporter) | Energy production and conversion [C] | 1.00 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
COG3502 | Uncharacterized conserved protein, DUF952 family | Function unknown [S] | 1.00 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.00 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.00 % |
Unclassified | root | N/A | 28.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10196594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102404898 | Not Available | 734 | Open in IMG/M |
3300001372|YBBDRAFT_1251852 | Not Available | 2176 | Open in IMG/M |
3300001850|RCM37_1129634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 661 | Open in IMG/M |
3300005328|Ga0070676_10442983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300005329|Ga0070683_100034650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 4613 | Open in IMG/M |
3300005329|Ga0070683_100164440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2105 | Open in IMG/M |
3300005334|Ga0068869_100340994 | Not Available | 1219 | Open in IMG/M |
3300005334|Ga0068869_100342783 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300005340|Ga0070689_100484124 | Not Available | 1057 | Open in IMG/M |
3300005340|Ga0070689_100846739 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005367|Ga0070667_101483155 | Not Available | 637 | Open in IMG/M |
3300005444|Ga0070694_101680786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 540 | Open in IMG/M |
3300005459|Ga0068867_100345224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300005459|Ga0068867_101506467 | Not Available | 626 | Open in IMG/M |
3300005468|Ga0070707_102113427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300005518|Ga0070699_101815037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005535|Ga0070684_100463998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
3300005535|Ga0070684_101022945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300005539|Ga0068853_100979344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300005549|Ga0070704_101137497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300005577|Ga0068857_100552595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
3300005614|Ga0068856_100923402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300005614|Ga0068856_101070770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300005616|Ga0068852_100364264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1415 | Open in IMG/M |
3300005836|Ga0074470_11070666 | All Organisms → cellular organisms → Bacteria | 19111 | Open in IMG/M |
3300005842|Ga0068858_100339360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
3300005842|Ga0068858_100862529 | Not Available | 884 | Open in IMG/M |
3300006052|Ga0075029_100227435 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300006059|Ga0075017_100148699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
3300006059|Ga0075017_100208150 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300006163|Ga0070715_10637525 | Not Available | 629 | Open in IMG/M |
3300006354|Ga0075021_10160793 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300006358|Ga0068871_100571947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300006358|Ga0068871_100660769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300006638|Ga0075522_10024457 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
3300006755|Ga0079222_10506912 | Not Available | 886 | Open in IMG/M |
3300006806|Ga0079220_12018613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300006954|Ga0079219_11161890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300009098|Ga0105245_10220432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1830 | Open in IMG/M |
3300009098|Ga0105245_10925754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
3300009098|Ga0105245_11327743 | Not Available | 768 | Open in IMG/M |
3300009101|Ga0105247_11362550 | Not Available | 572 | Open in IMG/M |
3300009148|Ga0105243_10076878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2714 | Open in IMG/M |
3300009148|Ga0105243_10166354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
3300009161|Ga0114966_10261979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300009176|Ga0105242_11196886 | Not Available | 779 | Open in IMG/M |
3300010375|Ga0105239_10970218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300010401|Ga0134121_10225054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
3300012929|Ga0137404_11481815 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300013102|Ga0157371_11287234 | Not Available | 565 | Open in IMG/M |
3300013105|Ga0157369_10127579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2696 | Open in IMG/M |
3300013297|Ga0157378_11513184 | Not Available | 716 | Open in IMG/M |
3300013308|Ga0157375_11779480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300013308|Ga0157375_12305054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300014325|Ga0163163_10445219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
3300014326|Ga0157380_12148811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 622 | Open in IMG/M |
3300014492|Ga0182013_10033218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4263 | Open in IMG/M |
3300014499|Ga0182012_10112447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2022 | Open in IMG/M |
3300014501|Ga0182024_11312385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300014657|Ga0181522_10948062 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300014969|Ga0157376_11087783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
3300018062|Ga0187784_10478341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300018064|Ga0187773_10070007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
3300018090|Ga0187770_10597792 | Not Available | 877 | Open in IMG/M |
3300018482|Ga0066669_11557368 | Not Available | 602 | Open in IMG/M |
3300021170|Ga0210400_10238065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
3300021432|Ga0210384_11017544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300021859|Ga0210334_10933661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 531 | Open in IMG/M |
3300022213|Ga0224500_10357131 | Not Available | 528 | Open in IMG/M |
3300025324|Ga0209640_11407271 | Not Available | 509 | Open in IMG/M |
3300025905|Ga0207685_10599161 | Not Available | 591 | Open in IMG/M |
3300025911|Ga0207654_10111016 | Not Available | 1706 | Open in IMG/M |
3300025916|Ga0207663_10075404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2189 | Open in IMG/M |
3300025924|Ga0207694_10116141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2133 | Open in IMG/M |
3300025932|Ga0207690_10390835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300025934|Ga0207686_10291656 | Not Available | 1208 | Open in IMG/M |
3300025936|Ga0207670_10153751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1710 | Open in IMG/M |
3300025944|Ga0207661_10003969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10336 | Open in IMG/M |
3300026035|Ga0207703_10847261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
3300026035|Ga0207703_11609399 | Not Available | 625 | Open in IMG/M |
3300026041|Ga0207639_11867464 | Not Available | 562 | Open in IMG/M |
3300026075|Ga0207708_10574596 | Not Available | 953 | Open in IMG/M |
3300026089|Ga0207648_10796123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300026116|Ga0207674_10524155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
3300026142|Ga0207698_10158930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1974 | Open in IMG/M |
3300026142|Ga0207698_11794076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 629 | Open in IMG/M |
3300026320|Ga0209131_1019396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4104 | Open in IMG/M |
3300027775|Ga0209177_10231436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300027831|Ga0209797_10360046 | Not Available | 597 | Open in IMG/M |
3300027842|Ga0209580_10170528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300027894|Ga0209068_10033850 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
3300027915|Ga0209069_10198612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1022 | Open in IMG/M |
3300029913|Ga0311362_10964582 | Not Available | 673 | Open in IMG/M |
3300029917|Ga0311326_10574734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300030019|Ga0311348_11389643 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300030943|Ga0311366_11844802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300031720|Ga0307469_12042931 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300031902|Ga0302322_102369146 | Not Available | 654 | Open in IMG/M |
3300032144|Ga0315910_10729761 | Not Available | 770 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 7.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.00% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 1.00% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.00% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.00% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_101965941 | 3300000567 | Peatlands Soil | MERDGIRTCDSCGQRIPPMSKLATRQDGPDGKDVCLACQIRVAQIEKGLRH* |
JGIcombinedJ13530_1024048982 | 3300001213 | Wetland | MEKDGQRYCDGCGQVIPKMSKLASKEGDKDYCLSCSIRKAQDEKGLKH* |
YBBDRAFT_12518523 | 3300001372 | Marine Estuarine | IIAYMEKDGKRVCDGCGKLIPQKAMLAAKENGKDLCLACQIREAQITKGLRH* |
RCM37_11296342 | 3300001850 | Marine Plankton | MEKDGVRCCDGCGQVIPKMSKLATKGPDGRDLCLACQIRESEIRKGLR* |
Ga0070676_104429832 | 3300005328 | Miscanthus Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP* |
Ga0070683_1000346502 | 3300005329 | Corn Rhizosphere | MERDGIRTCDSCGQRIPPMSKLATRQEGPDGKDLCLACQIRLAQVEKGLRH* |
Ga0070683_1001644402 | 3300005329 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGSKDFCLACQIRQSEINKGLRP* |
Ga0068869_1003409942 | 3300005334 | Miscanthus Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGAKDFCLACQIRQSEINKGLRP* |
Ga0068869_1003427832 | 3300005334 | Miscanthus Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP* |
Ga0070689_1004841241 | 3300005340 | Switchgrass Rhizosphere | MERDGIRTCDSCGQRIPPMSKLASRENGQDLCLACQIRLAQIEKGLRH* |
Ga0070689_1008467392 | 3300005340 | Switchgrass Rhizosphere | MEKDGQRICDKCGQKIPSMSKLATRENGRDLCLACQIREAQDEKGLRH* |
Ga0070667_1014831552 | 3300005367 | Switchgrass Rhizosphere | MEKDGERICDGCGQRIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH* |
Ga0070694_1016807862 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKDGERICDGCGQKIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH* |
Ga0068867_1003452241 | 3300005459 | Miscanthus Rhizosphere | HRDMEKDGNRYCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP* |
Ga0068867_1015064672 | 3300005459 | Miscanthus Rhizosphere | SMEKDGVRTCDSCGQRIPSMSKLAAKSADGRDLCLACKIRESEIKKGLGL* |
Ga0070707_1021134272 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKDGNRFCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP* |
Ga0070699_1018150371 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RICDGCGQKIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH* |
Ga0070684_1004639982 | 3300005535 | Corn Rhizosphere | HMERDGIRTCDSCGQRIPPMSKLSSQKDGKDLCLACQIRLAQIEKGLRH* |
Ga0070684_1010229451 | 3300005535 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGGRDFCLACQIRQSEINKGLRP* |
Ga0068853_1009793441 | 3300005539 | Corn Rhizosphere | DGNRYCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP* |
Ga0070704_1011374971 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RRSRYDRCMQKDGERICDGCGQKIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH* |
Ga0068857_1005525951 | 3300005577 | Corn Rhizosphere | ARYHRGMEKDGNRYCDSCGQKIPSMAKLASKEDGKDFCLACQIRQAQIAKGLRH* |
Ga0068856_1009234023 | 3300005614 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPTMAKLASKEDGKDFCLACQIRQAQIAKGLRH* |
Ga0068856_1010707701 | 3300005614 | Corn Rhizosphere | RIPPVSKLAAHQDGKDLCLACQIRLAQIEKGLRH* |
Ga0068852_1003642644 | 3300005616 | Corn Rhizosphere | MEKDGKRVCDGCGQTIPMMSKLASKEDGRDLCLQCQIRDAQIHKGLKH* |
Ga0074470_110706662 | 3300005836 | Sediment (Intertidal) | MEKDGDRYCDSCGQVIPKMSKLASTEGGQDLCLACKIRKAQIEKGLHH* |
Ga0068858_1003393602 | 3300005842 | Switchgrass Rhizosphere | CDSCGQRIPPMSKLAARQDGPDGKDLCLACQIRLAQIEKGLRH* |
Ga0068858_1008625292 | 3300005842 | Switchgrass Rhizosphere | MEKDGQRICDRCGLKIPSMSKLATRENGRDLCLACQIREAQEEKGLRH* |
Ga0075029_1002274352 | 3300006052 | Watersheds | MGKTDMEKDGVRVCDGCGQPIPKKAMLAIKENGQALCLACQIRDAQINKGLRH* |
Ga0075017_1001486992 | 3300006059 | Watersheds | MEKDGNRICDSCGQKIPSMSKLASKENGKDLCLACQIRLAQIEKGLRH* |
Ga0075017_1002081502 | 3300006059 | Watersheds | MKFMEQNQQRVCAGCGQPIPSMSKLAQKTADGKELCLACQIREAEIRKGR* |
Ga0070715_106375251 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | CDSCGQRIPPMSKLASHQEGKDLCLACQIRLAQVEKGLRH* |
Ga0075021_101607932 | 3300006354 | Watersheds | MEKDGQRFCDDCGKPIPLQAKLAEKTAEGKDRCLACQIRDAQITKGLRH* |
Ga0068871_1005719471 | 3300006358 | Miscanthus Rhizosphere | ERDGIRTCDSCGQRIPPMSKLASRENGQDLCLACQIRLAQIEKGLRH* |
Ga0068871_1006607692 | 3300006358 | Miscanthus Rhizosphere | YCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP* |
Ga0075522_100244573 | 3300006638 | Arctic Peat Soil | MEKDGERTCDGCGQPIPKMSKLALKSEDGKDLCLACQIRESERKKGLRP* |
Ga0079222_105069122 | 3300006755 | Agricultural Soil | MERDGVRTCDSCGQKIPPMSKLASKEHGKDLCLACQIRLAQIEKGLRH* |
Ga0079220_120186131 | 3300006806 | Agricultural Soil | MEKDGNRHCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP* |
Ga0079219_111618901 | 3300006954 | Agricultural Soil | MEKDGKRICDSCGQPIPSMSKLASRENGKDFCLACQIRQAEIAKGLRQ* |
Ga0105245_102204322 | 3300009098 | Miscanthus Rhizosphere | MEKDGQRICDKCGQRIPSTSKLSTRENGKDLCLACQIREAQDEKGLRH* |
Ga0105245_109257541 | 3300009098 | Miscanthus Rhizosphere | HMERDGIRTCDSCGQRIPPMSKLASREDDKDLCLACQIRLAQVEKGLRH* |
Ga0105245_113277432 | 3300009098 | Miscanthus Rhizosphere | MEKDGQRICDRCGLKIPSMFKLATHENGRDLCLACQIREAQEEKGLRH* |
Ga0105247_113625502 | 3300009101 | Switchgrass Rhizosphere | HPAPRARYHQSMEKDGSRYCDSCGQKIPSMSKLASKEGAKDFCLACQIRQSEINKGLRP* |
Ga0105243_100768781 | 3300009148 | Miscanthus Rhizosphere | GQRIPPMSKLASRENGQDLCLACQIRLAQIEKGLRH* |
Ga0105243_101663542 | 3300009148 | Miscanthus Rhizosphere | MEKDGQRICDRCGLKIPSMSKLATRSGVDGAGRDLCLACQIREAQEEKGLRH* |
Ga0114966_102619791 | 3300009161 | Freshwater Lake | MEKDGVRVCDGCGHRIPSMSKLAVKEGGRDLCLQCQIKDAQINKGLKH* |
Ga0105242_111968862 | 3300009176 | Miscanthus Rhizosphere | MEKDGQRICDRCGLKIPSMSKLATHENGRDLCLACQIREAQEEKGLRH* |
Ga0105239_109702182 | 3300010375 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPSMAKLASKEDGKDFCLACQIRQAQIAKGLRH* |
Ga0134121_102250542 | 3300010401 | Terrestrial Soil | MEKDGERICDGCGQKIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH* |
Ga0137404_114818152 | 3300012929 | Vadose Zone Soil | MVKNGERICDGCGQKIPSMSKLAIQQDGNDLCLQCQIREAQIAKGLRH* |
Ga0157371_112872342 | 3300013102 | Corn Rhizosphere | MEKDGVRTCDACGQRIPPFSKLAAKSSDGRDLCLACRIRESEIKKGLGL* |
Ga0157369_101275792 | 3300013105 | Corn Rhizosphere | MEQDGIRTCDSCGQRIPPMSKLATRQDNKDLCLACQIRLAQIQKGLRH* |
Ga0157378_115131842 | 3300013297 | Miscanthus Rhizosphere | VERDGIRTCDSCGQRIPPMSKLASREDDKDLCLACQIRLAQVEKGLRH* |
Ga0157375_117794801 | 3300013308 | Miscanthus Rhizosphere | MERDGIRTCDSCGQRIPPMSKLASREDDKDLCLACQIRLAQIEKGLRH* |
Ga0157375_123050542 | 3300013308 | Miscanthus Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGGKDVCLACQIRQSEINKGLRP* |
Ga0163163_104452191 | 3300014325 | Switchgrass Rhizosphere | ARYHRGMEKDGNRFCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP* |
Ga0157380_121488112 | 3300014326 | Switchgrass Rhizosphere | MEKDGKRICDKCGQKIPSMSKLATRENGRDSCLACQIREAQDEKGLRH* |
Ga0182013_100332182 | 3300014492 | Bog | MKFMEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIREAERQKRPL* |
Ga0182012_101124471 | 3300014499 | Bog | MKFMEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIREAERQKRP |
Ga0182024_113123851 | 3300014501 | Permafrost | IRTCDSCGQRIPPMSKLATRQGDKDLCLACQIRLAQIEKGLRH* |
Ga0181522_109480621 | 3300014657 | Bog | ERICDLCGQTIPKMSKLAWKQDGKDLCLACQIRESERRKPR* |
Ga0157376_110877832 | 3300014969 | Miscanthus Rhizosphere | ICDRCGLKIPSMSKLATHENGRDLCLACQIREAQEEKGLRH* |
Ga0187784_104783412 | 3300018062 | Tropical Peatland | MEKDGERFCDACGQPIPKVSKLAVKEDGKDFCLACQIRESERKKGLRP |
Ga0187773_100700072 | 3300018064 | Tropical Peatland | MEKDGERTCDGCGQPIPKMSKLALKSEDGKDLCLACQIRESERKKGLRP |
Ga0187770_105977921 | 3300018090 | Tropical Peatland | MQKDGERFCDGCGQPIPKMSKLARNEDGKDFCLACQIRESERKKGLRP |
Ga0066669_115573683 | 3300018482 | Grasslands Soil | MEKDGNRYCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP |
Ga0210400_102380655 | 3300021170 | Soil | MERDGIRTCDSCGQRIPPMSKLATRQEGPDGKDVCLACQIRLAQIEKGLRH |
Ga0210384_110175442 | 3300021432 | Soil | MEKDGDRHCDQCGQKIPKMAKLAVQQSGRDLCLACQIRLAQIEKGLRH |
Ga0210334_109336612 | 3300021859 | Estuarine | MEKDGVKVCDGCGQRIPSMSKLATKEGDRDLCLQCQIKDAQVTKGLKH |
Ga0224500_103571312 | 3300022213 | Sediment | MEKDGKRICDGCGQTIPSMSKLAVKEGGRDLCLQCQIKDAQINKGLKH |
Ga0209640_114072712 | 3300025324 | Soil | MEKDGERVCDSCGQKIPKMSKLATREGGRDLCLACQIREAQIHKGLRH |
Ga0207685_105991611 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RFRRRVTICFMEQDGIRTCDSCGQRIPPMSKLASRQDGKDLCLACQIRLAQTEKGLRH |
Ga0207654_101110162 | 3300025911 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEGSKDFCLACQIRQSEINKGLRP |
Ga0207663_100754041 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | CDSCGQRIPPMSKLATRQDGPEGRDLCLACQIRLAQIEKGLRH |
Ga0207694_101161413 | 3300025924 | Corn Rhizosphere | DGIRTCDSCGQRIPPMSKLATRQDNKDLCLACQIRLAQIQKGLRH |
Ga0207690_103908352 | 3300025932 | Corn Rhizosphere | RARYHRDMEKDGNRYCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP |
Ga0207686_102916563 | 3300025934 | Miscanthus Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASREGGKDFCLACQIRQSEINKGLRP |
Ga0207670_101537512 | 3300025936 | Switchgrass Rhizosphere | MEKDGQRICDKCGQKIPSMSKLATRENGRDLCLACQIREAQDEKGLRH |
Ga0207661_100039692 | 3300025944 | Corn Rhizosphere | VRSAPRYHRHMERDGIRTCDSCGQRIPPMSKLSSQKDGKDLCLACQIRLAQIEKGLRH |
Ga0207703_108472611 | 3300026035 | Switchgrass Rhizosphere | HRDMEKDGNRYCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP |
Ga0207703_116093991 | 3300026035 | Switchgrass Rhizosphere | CDSCGQRIPPMSKLAARQDGPDGKDLCLACQIRLAQIEKGLRH |
Ga0207639_118674641 | 3300026041 | Corn Rhizosphere | YCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEINKGLRP |
Ga0207708_105745961 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKDGERICDGCGQKIPRMSKLALQQDGKDLCLQCQIRDAQINKGLRH |
Ga0207648_107961231 | 3300026089 | Miscanthus Rhizosphere | RDMEKDGNRYCDSCGQKIPSMSKLASKEGGKDFCLACQIRQSEINKGLRP |
Ga0207674_105241552 | 3300026116 | Corn Rhizosphere | ARYHRGMEKDGNRYCDSCGQKIPSMAKLASKEDGKDFCLACQIRQAQIAKGLRH |
Ga0207698_101589303 | 3300026142 | Corn Rhizosphere | MEKDGNRYCDSCGQKIPSMSKLASKEDGKDFCLACQIRQSEITKGLRP |
Ga0207698_117940762 | 3300026142 | Corn Rhizosphere | MEKDGKRVCDGCGQTIPMMSKLASKEDGRDLCLQCQIRDAQIHKGLKH |
Ga0209131_10193963 | 3300026320 | Grasslands Soil | MLKDGETDAVRICHVCGQKIPSMSKLAIQQDGKDICLQCQIRDAQINKGLRH |
Ga0209177_102314362 | 3300027775 | Agricultural Soil | MERDGVRTCDSCGQKIPPMSKLASKEHGKDLCLACQIRLAQIEKGLRH |
Ga0209797_103600462 | 3300027831 | Wetland Sediment | MEKDGVKLCDGCGQRIPSMSKLAVKEGGRDLCLQCQIKDAQINKGLKH |
Ga0209580_101705282 | 3300027842 | Surface Soil | MERDGIRTCDSCGQKIPPMSKLAAREDGKDFCLACQIRLAQIEKGLRH |
Ga0209068_100338502 | 3300027894 | Watersheds | MEKDGQRFCDDCGKPIPLQAKLAEKTAEGKDRCLACQIRDAQITKGLRH |
Ga0209069_101986123 | 3300027915 | Watersheds | MQKDGQRFCDHCGKPIPSMSKLAMKTDDGKDLCLACQIQDAQLTKGLRH |
Ga0311362_109645821 | 3300029913 | Bog | MKFMEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIREAERQKRPL |
Ga0311326_105747341 | 3300029917 | Bog | AFARTMKFMEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIREAERQKRPL |
Ga0311348_113896431 | 3300030019 | Fen | NKSMEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIRESERQKRLRP |
Ga0311366_118448022 | 3300030943 | Fen | MEKDGERICDLCGQTIPKMSKLALKQDGKDLCLACQIRESERQKRLRP |
Ga0307469_120429312 | 3300031720 | Hardwood Forest Soil | MERDGVRTCDSCGQRIPPMSKLASHQEGKDLCLACQIRLAQIEKGLRH |
Ga0302322_1023691462 | 3300031902 | Fen | MRLYYRAGRVIITVMEKDGERVCDGCGRPIPKKAMLATKENGKDLCLACQIRDAQITKGLRH |
Ga0315910_107297612 | 3300032144 | Soil | CVTILSGEEFMEKDGVRVCDGCGQRIPSKSKLAVKEGGRDLCLQCQIKDAQINKGLKH |
⦗Top⦘ |