NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106197

Metagenome / Metatranscriptome Family F106197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106197
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 142 residues
Representative Sequence MKRVLVCILLLLLCMSVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAEIGSYQADFYLYGYYDSRTGELSNQLDQVDQVSAFSVVG
Number of Associated Samples 81
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 56.00 %
% of genes near scaffold ends (potentially truncated) 23.00 %
% of genes from short scaffolds (< 2000 bps) 66.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (98.000 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(24.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(23.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 9.36%    β-sheet: 42.69%    Coil/Unstructured: 47.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.1.18.3: Arthropod hemocyanin, C-terminal domaind1llaa31lla0.65172
b.1.22.0: automated matchesd6a6ya_6a6y0.64636
b.2.5.7: DNA-binding domain from NDT80d1mnna_1mnn0.63772
b.1.18.3: Arthropod hemocyanin, C-terminal domaind1hc1a31hc10.63753
b.1.31.0: automated matchesd2wt3a32wt30.63652


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13382Adenine_deam_C 5.00
PF04055Radical_SAM 4.00
PF00072Response_reg 2.00
PF02885Glycos_trans_3N 2.00
PF00485PRK 2.00
PF02811PHP 2.00
PF02310B12-binding 2.00
PF17200sCache_2 2.00
PF00398RrnaAD 1.00
PF02391MoaE 1.00
PF03091CutA1 1.00
PF05016ParE_toxin 1.00
PF01922SRP19 1.00
PF01487DHquinase_I 1.00
PF05168HEPN 1.00
PF01169UPF0016 1.00
PF00160Pro_isomerase 1.00
PF11842DUF3362 1.00
PF13673Acetyltransf_10 1.00
PF04919DUF655 1.00
PF13599Pentapeptide_4 1.00
PF00512HisKA 1.00
PF02518HATPase_c 1.00
PF08269dCache_2 1.00
PF00709Adenylsucc_synt 1.00
PF02597ThiS 1.00
PF06463Mob_synth_C 1.00
PF00702Hydrolase 1.00
PF00561Abhydrolase_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 1.00
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 1.00
COG0314Molybdopterin synthase catalytic subunit MoaECoenzyme transport and metabolism [H] 1.00
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 1.00
COG07103-dehydroquinate dehydrataseAmino acid transport and metabolism [E] 1.00
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 1.00
COG1400Signal recognition particle subunit SEC65Intracellular trafficking, secretion, and vesicular transport [U] 1.00
COG1491Predicted nucleic acid-binding OB-fold proteinGeneral function prediction only [R] 1.00
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 1.00
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 1.00
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 1.00
COG2119Putative Ca2+/H+ antiporter, TMEM165/GDT1 familyGeneral function prediction only [R] 1.00
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 1.00
COG2896GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)Coenzyme transport and metabolism [H] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_164387_len_1859_cov_8_642281All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121909Open in IMG/M
2140918025|NODE_218432_length_754_cov_12.051724All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112804Open in IMG/M
3300002171|JGI24732J26686_1064584All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112605Open in IMG/M
3300002564|JGI24134J36421_10069426All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112920Open in IMG/M
3300003432|JGI20214J51088_10098964All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii2053Open in IMG/M
3300003432|JGI20214J51088_10517281All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112766Open in IMG/M
3300003910|JGI26437J51864_10060274All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112817Open in IMG/M
3300004282|Ga0066599_101303182All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112548Open in IMG/M
3300004481|Ga0069718_15254551All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix harundinacea1426Open in IMG/M
3300004775|Ga0007798_10004799All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia3462Open in IMG/M
3300004775|Ga0007798_10005337All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii3243Open in IMG/M
3300005259|Ga0071344_1018618All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii10794Open in IMG/M
3300005259|Ga0071344_1090863All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112829Open in IMG/M
3300005263|Ga0071346_1003531All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii9954Open in IMG/M
3300005263|Ga0071346_1013563All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia7209Open in IMG/M
3300005323|Ga0074198_1013614All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii2189Open in IMG/M
3300005325|Ga0074199_1115318All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112509Open in IMG/M
3300005326|Ga0074195_1049277All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia1398Open in IMG/M
3300006652|Ga0101729_1029283All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112770Open in IMG/M
3300006795|Ga0075520_1327972All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112625Open in IMG/M
3300006888|Ga0102492_123470All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112735Open in IMG/M
3300009047|Ga0116019_10023470All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112735Open in IMG/M
3300009081|Ga0105098_10801034All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112509Open in IMG/M
3300009085|Ga0105103_10762898All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112559Open in IMG/M
3300009111|Ga0115026_10608691All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112830Open in IMG/M
3300009131|Ga0115027_10926763All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112676Open in IMG/M
3300009146|Ga0105091_10251424All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112853Open in IMG/M
3300009167|Ga0113563_10557847All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121261Open in IMG/M
3300009169|Ga0105097_10796077All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112539Open in IMG/M
3300009502|Ga0114951_10000046All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii158491Open in IMG/M
3300009692|Ga0116171_10009430All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii8017Open in IMG/M
3300009694|Ga0116170_10002993All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii15959Open in IMG/M
3300011340|Ga0151652_11146060All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112596Open in IMG/M
3300011340|Ga0151652_12785779All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112537Open in IMG/M
3300014208|Ga0172379_10965911All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112502Open in IMG/M
3300014309|Ga0075317_1166043All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112525Open in IMG/M
3300014490|Ga0182010_10012414All Organisms → cellular organisms → Bacteria3841Open in IMG/M
3300014490|Ga0182010_10228714All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112982Open in IMG/M
3300014490|Ga0182010_10319782All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112835Open in IMG/M
3300014496|Ga0182011_10061205All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122653Open in IMG/M
3300014498|Ga0182019_10637697All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112751Open in IMG/M
3300014502|Ga0182021_10175170All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122502Open in IMG/M
3300014502|Ga0182021_10713790All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121202Open in IMG/M
3300014502|Ga0182021_13791038All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112501Open in IMG/M
3300014839|Ga0182027_10395202All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121538Open in IMG/M
3300018060|Ga0187765_10874247All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112606Open in IMG/M
3300019273|Ga0187794_1438177All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112847Open in IMG/M
3300019788|Ga0182028_1028868All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112839Open in IMG/M
3300019861|Ga0206388_1116774All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii3344Open in IMG/M
3300020163|Ga0194039_1001461All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix12683Open in IMG/M
3300020228|Ga0194040_1014371All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122241Open in IMG/M
3300021520|Ga0194053_10016810All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix3524Open in IMG/M
3300022555|Ga0212088_10000125All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii158499Open in IMG/M
3300025447|Ga0208102_1016745All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121287Open in IMG/M
3300025476|Ga0208495_1040976All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112837Open in IMG/M
3300025575|Ga0209430_1102756All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112667Open in IMG/M
3300025739|Ga0209745_1030822All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122155Open in IMG/M
3300025852|Ga0209124_10108938All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121141Open in IMG/M
3300025858|Ga0209099_1000054All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix122367Open in IMG/M
3300025888|Ga0209540_10107914All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121703Open in IMG/M
3300027419|Ga0209340_1030604All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1447Open in IMG/M
3300027675|Ga0209077_1193993All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112567Open in IMG/M
3300027885|Ga0209450_10213015All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121370Open in IMG/M
3300027890|Ga0209496_10449495All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112677Open in IMG/M
3300027896|Ga0209777_10011487All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix9297Open in IMG/M
3300027896|Ga0209777_10363734All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121098Open in IMG/M
3300027896|Ga0209777_10373324All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121080Open in IMG/M
3300027896|Ga0209777_10389706All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121051Open in IMG/M
3300027896|Ga0209777_10688599All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112729Open in IMG/M
(restricted) 3300028581|Ga0247840_10000451All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii85258Open in IMG/M
(restricted) 3300028581|Ga0247840_10063176All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii2735Open in IMG/M
(restricted) 3300029268|Ga0247842_10004148All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix18529Open in IMG/M
(restricted) 3300029286|Ga0247841_10024947All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix6585Open in IMG/M
3300029798|Ga0239581_1000285All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii45590Open in IMG/M
3300029959|Ga0272380_10006759All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii17528Open in IMG/M
3300029959|Ga0272380_10614852All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112706Open in IMG/M
3300030000|Ga0311337_10802350All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112817Open in IMG/M
3300030493|Ga0310040_1000551All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii33823Open in IMG/M
3300030943|Ga0311366_11579056All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112562Open in IMG/M
3300031232|Ga0302323_102974798All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112541Open in IMG/M
3300031759|Ga0316219_1172356All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112789Open in IMG/M
3300031873|Ga0315297_11182775All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112627Open in IMG/M
3300031952|Ga0315294_10118724All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii2718Open in IMG/M
3300032070|Ga0315279_10148917All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1905Open in IMG/M
3300032143|Ga0315292_10068345All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2694Open in IMG/M
3300032164|Ga0315283_10169624All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2339Open in IMG/M
3300032342|Ga0315286_10420765All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121401Open in IMG/M
3300032342|Ga0315286_11275420All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112715Open in IMG/M
3300032397|Ga0315287_11626108All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112726Open in IMG/M
3300032401|Ga0315275_10630705All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121196Open in IMG/M
3300032401|Ga0315275_11052315All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112892Open in IMG/M
3300032516|Ga0315273_10000940All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii31934Open in IMG/M
3300032516|Ga0315273_13206123All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112506Open in IMG/M
3300033418|Ga0316625_100914143All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112770Open in IMG/M
3300033419|Ga0316601_101628157All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112651Open in IMG/M
3300034169|Ga0370480_0001950All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii8055Open in IMG/M
3300034195|Ga0370501_0143033All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112825Open in IMG/M
3300034281|Ga0370481_0002035Not Available5223Open in IMG/M
3300034281|Ga0370481_0226616All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112666Open in IMG/M
3300034652|Ga0316598_194229All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112574Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen10.00%
Bioremediated Contaminated GroundwaterEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater8.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment7.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil6.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.00%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil5.00%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.00%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.00%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.00%
SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment3.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.00%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge3.00%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland2.00%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.00%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.00%
Anaerobic Enrichment CultureEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918025Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300002171Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23EngineeredOpen in IMG/M
3300002564Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004775Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17MEnvironmentalOpen in IMG/M
3300005259Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1EnvironmentalOpen in IMG/M
3300005263Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3EnvironmentalOpen in IMG/M
3300005323Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23EngineeredOpen in IMG/M
3300005325Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47EngineeredOpen in IMG/M
3300005326Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23EngineeredOpen in IMG/M
3300006652Combined Assembly of Gp0123698, Gp0123960, Gp0123961EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006888Combined Assembly of Gp0125122, Gp0125123, Gp0125658EnvironmentalOpen in IMG/M
3300009047Combined Assembly of De NOVO T14 (BES) Tyne Sediment Benzoate Gp0125122, Gp0125123, Gp0125658EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009692Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaGEngineeredOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300014208Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaGEnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019861Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1EngineeredOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300020228Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10mEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300025447Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M (SPAdes)EnvironmentalOpen in IMG/M
3300025476Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M (SPAdes)EnvironmentalOpen in IMG/M
3300025575Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes)EnvironmentalOpen in IMG/M
3300025739Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025858Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300027419Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 (SPAdes)EngineeredOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029798Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11EnvironmentalOpen in IMG/M
3300029959EPA Superfund site combined assemblyEngineeredOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030493Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 (v2)EngineeredOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_011923302124908028SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
b3_nosca_v_022913802140918025SoilAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
JGI24732J26686_106458413300002171Bioremediated Contaminated GroundwaterQLQKIYSVVADVKSALACFLLLLLVTGMESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWAIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG*
JGI24134J36421_1006942613300002564Arctic Peat SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYGYYDPHTGELSDQLDQVAQVSAFSIVG*
JGI20214J51088_1009896413300003432WetlandMKIVLVCILLLLPWVCVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANIWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLAGAFSVVG*
JGI20214J51088_1051728123300003432WetlandMKKVLLCVLLLLLWICVDCVSADTISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYADPGSSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLVGAFSVVG*
JGI26437J51864_1006027413300003910Freshwater Lake SedimentMKRVLVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGADAWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG*
Ga0066599_10130318213300004282FreshwaterMKRFLIGILLLLLCVSMNSASAVSISAQIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDNAEIGSYQADFYLYAYYDTYTGELLDQLDQIAQVSAFSVVG*
Ga0069718_1525455133300004481SedimentNARLKEVAKKYLAVIDMKRVLVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG*
Ga0007798_1000479943300004775FreshwaterMKRVLVCIILSLLWICVDSVSADTISAQIDSFDFPSGDWYRGSNQGGVNAWIKNTGDVGHLFWVSYEVMDRRGQWYNAPPEPVYAEPGSSTYFVDPVWHIPDDAELGSYQADLYLYSYYDSNTGELSEQLDQVDQAGAFSVVG*
Ga0007798_1000533733300004775FreshwaterMKIVLVCIPLLLLCLSVDTVSADTISAQIDSFNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPQPIYAEPGIDTYFVDPVWHIPDDAELGSYQADLYLYGYYDSNTGELSEQLDQVDQVSAFSVVG*
Ga0071344_1018618113300005259Anaerobic Enrichment CultureMKIVLVCILLLLPWICVDCVSAETISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAQPGDSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLAGAFSVVG*
Ga0071344_109086313300005259Anaerobic Enrichment CultureVVLGMKKVLLCILLLLLWICVDCVSADTISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWQRAPPEPVYADPGSSTYXXXXSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLVGAFSVVG*
Ga0071346_1003531113300005263Anaerobic Enrichment CultureMKEVLVCILLLLLWMCVDCVSADTISAQIDSFDFPSGDWYRGXRGSDQGGANIWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYADPGSSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEELDQVDLAGAFSVVG*
Ga0071346_101356323300005263Anaerobic Enrichment CultureMKKVLLCILLLLLWICVDCVSADTISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWQRAPPEPVYADPGSSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSRTGELSEQLDQVDLVGAFSVVG*
Ga0074198_101361423300005323Bioremediated Contaminated GroundwaterMPITEICSVVADVKSALACFLLLLLVTGTESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG*
Ga0074199_111531813300005325Bioremediated Contaminated GroundwaterSASADTISGQIDSQNFPSGDWYRGPNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG*
Ga0074195_104927723300005326Bioremediated Contaminated GroundwaterVKSALACFLLLLLVTGMESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWAIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG*
Ga0101729_102928313300006652SedimentNNVWNSGNCKIHSEVLGMKRVLLCIPLLLLCISVDSVSADTISAQIDSFDFPSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVIPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*
Ga0075520_132797213300006795Arctic Peat SoilMKRVLIGILLLLLFVGVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG*
Ga0102492_12347023300006888SedimentVAAGVLAEVGFALGCYLFIQPFSTKCVSPILCISVDSVSADTISAQIDSFDFLSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*
Ga0116019_1002347023300009047SedimentVDSVSADTISAQIDSFDFLSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*
Ga0105098_1080103413300009081Freshwater SedimentMNSASAVSISAQIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYAYYDTYTGELLDQLDQVDQVGAFSVVG*
Ga0105103_1076289813300009085Freshwater SedimentMNSASAVSISAKIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDALIGSYQSDFYLYAYYDTYTGELLDQLDQVGQVSA
Ga0115026_1060869113300009111WetlandMKRVLVCIILSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG*
Ga0115027_1092676323300009131WetlandMKIILVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG*
Ga0105091_1025142413300009146Freshwater SedimentMNSASAVSISAKIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYAYYDTYTGELLDQLDQVDQVSAFIVVG*
Ga0113563_1055784723300009167Freshwater WetlandsMKRVLVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVNPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG*
Ga0105097_1079607713300009169Freshwater SedimentMNSASAGSISAQIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYAYYDTYTGELLDQLDQVAQVSAISVVG*
Ga0114951_10000046763300009502FreshwaterVGEIAKIYLEVVGMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTALPESVYAEPGSDTYFVSPRWHIPDDAQLGSYQADFYLYGYYNSRTGELSDQLDQVDQVGAFSVV*
Ga0116171_1000943023300009692Anaerobic Digestor SludgeMLWASLDCASASTISAQIDSYDFPSGDWYRDSDQGGTNVWIKNTGDVGHLFWISYEVMDKRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAELGSYQADLYLYSYYDDRTGEFSDQLDQVDEAGAFSVVG*
Ga0116170_10002993113300009694Anaerobic Digestor SludgeMLWASLDCASASTISAQIDSYDFPSGDWYRDSDQGGTNVWIKNTGDVGHLFWISYEVMDKRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAELGSYQADLYLYSYCDDRTGEFSDQLDQVDEAGAFSVVG*
Ga0151652_1114606023300011340WetlandMKIVLVCILLLLPWVCVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANIWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAELGSYQADFYLYSYYDSHTGELSEQLDQVDLAGAFSVVG*
Ga0151652_1278577913300011340WetlandMKMVLVYILLSLLWVSMDCASADTISAQIDSFDFPSGDWYRGSNQGGTNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYADPGDSTYFVNPVWHIPDDAELGSYQADLYLYSYYDSRTGELSEQLDQVDLAGAFSVVG*
Ga0172379_1096591113300014208GroundwaterMCAIMVLEKLKNHSISRKCPNADIISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAEPGDSTYFVNPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVSAFRVVG*
Ga0075317_116604313300014309Natural And Restored WetlandsMNSASAVSISAQIDSSDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEVGSYQADFYLYAYYDTYTGELLDQLDQVAQVSAF
Ga0182010_1001241443300014490FenMKGILAAILLFLLCISVDSVSAGSISAQIDSHDFPSGDWHRGQDQADAHVWIKNTGDTGHRFWVSYEVMDRRGRWYTAPPESVYTEPGSDSTWDVAPRLHIPNDAEIGSYQADFYLYGYYDSSTGEFSDLLDQVAQVGAFRVVG*
Ga0182010_1022871423300014490FenMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDNAQIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG*
Ga0182010_1031978213300014490FenMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG*
Ga0182011_1006120523300014496FenVDSASAGSISAQINSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPVWSIPDDAQIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG*
Ga0182019_1063769713300014498FenSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGNHTYFVSPVWSIPDDAEIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0182021_1017517033300014502FenMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGGWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDNAQIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG*
Ga0182021_1071379033300014502FenMKGILAAILLILLCISVESVSAGSISAQIDSHDFPSGDWHRGQDQADAHVWIKNTGDTGHRFWVSYEVMDRRGRWYTAPPESVYTEPGSDSTWDVAPRLHIPNDAEIGSYQADFYLYGYYDSSTGEFSDLLDQVAQVGAFRVVG*
Ga0182021_1379103813300014502FenLGSIEMKDILVSILLFLLCISVESASADTISAQIDSQDFPSGNWHQGQDQADAHVWIKNTGDVGHRFWVSYEVMDRRGQWYTAPPVSVYADPGDDTWFVGPRLHIPYDAELGPYQADFYLYGYYDSSTGELYDRLDQVDQVDAFRVVG*
Ga0182027_1039520223300014839FenMKRVLIGILLLLLCASVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWISYEVMDRRGKWYTAPPESVYAEPGNHTYFVSPVWGIPDDAEIGSNQADFCLYGYYDPYTGQLSDQLDQVAQVSAFSVVG*
Ga0187765_1087424723300018060Tropical PeatlandGMGVIVANRNLSGIEMKVVVVSILLFLLCTSVDFVSAGSISAQIDSQNFPSGDWYRGQDQADAHVWIKNTGDVGHRFWVSYEVMDRRGQWYTAPPVSVYADPGDDTWFVGPRLHIPYDAELGPYQADFYLYGYYDSSTGELYDQLDQVDQVDAFRVVG
Ga0187794_143817713300019273PeatlandIEMKGILVSILLFLLCISMESASADTISAQIDSQDFPSGNWHQGQDQADAHVWIKNTGDVGHRFWVSYEVMDRRGQWYTAPPVSVYADPGDDTWFVGPRLHIPYDAELGPYQADFYLYGYYDSSTGELYDLLDQVDQVDAFRVVG
Ga0182028_102886813300019788FenMKRVLVGILLLLLCVSVDSASAGSISAQINSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPVWSIPDDAQIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0206388_111677443300019861Anaerobic Enrichment CultureMKKVLVCIILLSLWICVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWQRAPPVPVYAEPGESTYFVNPVWHIPDDAELGSYQADFYLYSYYDSNTGEFSEQLDQVDQAGAFSVVG
Ga0194039_100146143300020163Anoxic Zone FreshwaterMKRVLICILLSLMWICVDSVSADTISAQIDSFDFPSGDWYRGSNQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGSSTYFVDPVWHIPDDAQLGSYQADLYLYSYYDSNTGELSELLDQVDQAGAFSVVG
Ga0194040_101437113300020228Anoxic Zone FreshwaterMAIAKKYLAVIGMKRVLICILLSLMWICVDSVSADTISAQIDSFDFPSGDWYRGSNQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGSSTYFVDPVWHIPDDAQLGSYQADLYLYSYYG
Ga0194053_1001681033300021520Anoxic Zone FreshwaterMAIAKKYLAVIGMKRVLICILLSLMWICVDSVSADTISAQIDSFDFPSGDWYRGSNQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGSSTYFVDPVWHIPDDAQLGSYQADLYLYSYYDSNTGELSELLDQVDQAGAFSVVG
Ga0212088_10000125753300022555Freshwater Lake HypolimnionMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTALPESVYAEPGSDTYFVSPRWHIPDDAQLGSYQADFYLYGYYNSRTGELSDQLDQVDQVGAFSVV
Ga0208102_101674513300025447FreshwaterPLLLLCLSVDTVSADTISAQIDSFNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPQPIYAEPGIDTYFVDPVWHIPDDAELGSYQADLYLYGYYDSNTGELSEQLDQVDQVSAFSVVG
Ga0208495_104097613300025476FreshwaterMKIVLVCIPLLLLCLSVDTVSADTISAQIDSFNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPQPIYAEPGIDTYFVDPVWHIPDDAELGSYQADLYLYGYYDSNTGELSEQLDQVDQVSAFSVVG
Ga0209430_110275613300025575Arctic Peat SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNIGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYGYYDPHTGELSDQLDQVAQVSAFSIVG
Ga0209745_103082243300025739Arctic Peat SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYGYYDPHTGELSDQLDQVAQVSAFSIVG
Ga0209124_1010893823300025852Arctic Peat SoilMKRVLIGILLLLLFVGVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0209099_1000054203300025858Anaerobic Digestor SludgeMKSVLVCILLSMLWASLDCASASTISAQIDSYDFPSGDWYRDSDQGGTNVWIKNTGDVGHLFWISYEVMDKRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAELGSYQADLYLYSYCDDRTGEFSDQLDQVDEAGAFSVVG
Ga0209540_1010791413300025888Arctic Peat SoilMKRVLIGILLLLLFVGVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTG
Ga0209340_103060413300027419Bioremediated Contaminated GroundwaterMPITEICSVVADVKSALACFLLLLLVTGTESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG
Ga0209077_119399313300027675Freshwater SedimentGMKRVLIGILLLLLCVSMNSASASSISAQIDSSDFPSGDWYRGSDQGGANVWIKNTGDEGRTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYAYYDTYTGELLDQLDQVDQVSAFIVVG
Ga0209450_1021301523300027885Freshwater Lake SedimentMKRVLVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGADAWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG
Ga0209496_1044949523300027890WetlandMKIILVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG
Ga0209777_1001148783300027896Freshwater Lake SedimentMKRVLVCIILSLLWICVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGSSTYFVDPVWHIPDDAQLGSYQADLYLYSYYDSNTGELSEQLDQVDLAGAFSVVG
Ga0209777_1036373413300027896Freshwater Lake SedimentMRSVFVCSLLVLLCVSVESVSAGTISAQIDSQDFPSGNWHQGQDQADAHVWIKNTGDVGHQFWVSYEVMDRRGRWYTAPPVSVYADPGNDTWSVSPRLSIPYDAEPGPYLADFYLYRYYDSSTGELQDRLDQVDRVDAFRVVG
Ga0209777_1037332413300027896Freshwater Lake SedimentMRSVFVCILLLLLFVSVESVSAGTISAQIDSQDFPSGNWHQGQDQADAHVWIKNTGDVGHQFWVSYEVMDRRGQWYTAPPESIFAEPGEATWFVSPRLHIPYDAELGFYQADFYLYGYYDSNTGELQDRLDQVDKVDAFRVVG
Ga0209777_1038970623300027896Freshwater Lake SedimentMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAQIGSYQADFYLYGSYDSRTGELSDQLDQVDQVSAFSVVG
Ga0209777_1068859913300027896Freshwater Lake SedimentVINRNLDGIEMKSALVCILLLLLCISVESASADTISAQIDSQDFPSGDWHRGQDQADAHVWIKNTGDIGHRFWVSYEVMDRRGQWYTAPPESVYADPGSDSTWFVGPRLHIPYDAELGSYQADFYLYAYYDSSTGEFSDLLDQVAQVGAFRVVG
(restricted) Ga0247840_10000451243300028581FreshwaterMPKLMAIAKKYFVVIGMKRVLVCILLSLLWICVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVDPVWHIPDDAQLGSYQADLYLYLYLYSYYDSCTGELLEQLDQVDLAGAFSVVG
(restricted) Ga0247840_1006317623300028581FreshwaterMKIVLVCIPLLLLCLSVDTVSADTISAQIDSFNFPSGDWYRGSNQGGANVWIINTGDVGHLFWVSYEVMDRKGQWYRAPPQPVYAEPGSDTYFVDPVWHIPDDAELGSYQADLYLYSYYDSRTGELSEQLDQVDQVSAFSVVG
(restricted) Ga0247842_10004148143300029268FreshwaterMAIAKKYFVVIGMKRVLVCILLSLLWICVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVDPVWHIPDDAQLGSYQADLYLYLYLYSYYDSCTGELLEQLDQVDLAGAFSVVG
(restricted) Ga0247841_1002494753300029286FreshwaterMKRVLLCILLSLLWICVDSVSADTISAQIDSFDFPSGDWYRGSNQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVDPVWHIPDDAELGSYQADLYLYSYYDSNTGELSEQLDQVDQAGAFSVVG
Ga0239581_1000285143300029798Freshwater LakeMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTALPESVYAEPGSXXXXDTYFVSPRWHIPDDAQLGSYQADFYLYGYYNSRTGELSDQLDQVDQVGAFSVV
Ga0272380_10006759113300029959Bioremediated Contaminated GroundwaterVKSALACFLLLLLVTGTESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG
Ga0272380_1061485213300029959Bioremediated Contaminated GroundwaterDLTLILIFLSNSVAKSDPPQTDSKSLNSNDCRLCQLQKIYSVVADVKSALACFLLLLLVTGMESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWAIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG
Ga0311337_1080235013300030000FenVDSASAGSISAQIASFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0310040_1000551123300030493Bioremediated Contaminated GroundwaterVADVKSALACFLLLLLVTGTESASADTISGQIDSQNFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDSRGRWYSAPPESVYADAGDNATYFVSPVWTIPDDAEIGSYQADFYLYGYYDSSTGELSDQLDQVDQPNAFSVVG
Ga0311366_1157905613300030943FenVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTTPPESVYAEPGSHTYFVSPVWSIPDDAEIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0302323_10297479813300031232FenMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDISHTFWVYYEVMDRRGKWYTAPPDSVYAEPGSDTYFVSPVWSIPDDAEIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0316219_117235613300031759FreshwaterMKRVLIGILLLLLCVSVDSASAGSISAQIDSFYFPSGDWYRGSDQGGANVWIKNTGDIGHTFWISYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPVWSIPDDAQIGSYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0315297_1118277523300031873SedimentMSVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAEIGSYQADFYLYEYYDSRTGELSNQLDQVDQVSAFSVVG
Ga0315294_1011872423300031952SedimentMESANADTISAQIDSYDFPSGYWHRGDDQADAHVWIKNTGDVGHLFWVSYSVMDWRGQWYSAPPVSVYADPGDDTWFLGPRWNIPYDAELGDYQAEFALYGYYDSSTGELFDLLDQADQAGAFRVIG
Ga0315279_1014891713300032070SedimentILLLLLCICVESANADTISAQIDSYDFPSGYWHRGDDQADAHVWIKNTGDVGHLFWVSYSVMDLSGQWYSAPPVSVYADPGDDTWFLGPRWHIPYDAVLGDYQAEFALYGYYDSSTGELFDLLDQADQAGAFRVIG
Ga0315292_1006834533300032143SedimentMSVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVNPIWHIPDDAQLGSYQANLYLYSYYDSRTGELSEQLDQVDQAGAFSVVG
Ga0315283_1016962433300032164SedimentMYTLWKAHYLKNPSILIMSELKEVTKKYLVVIDMKRVLVCILLLLLWICVDSVSADTISAQIDSFDFLSGDWYRWSDQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVNPIWHIPDDAQLGSYQANLYLYSYYDSRTGELSEQLDQVD
Ga0315286_1042076513300032342SedimentMSELKAVTKKYLVVIDMKRVLVCILLLLLWISVDSVSADTISAQIDSFDFPSGDWYRGSDQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVNPIWHIPDDAQLGSYQADLYLYSYYDSRTGELSEQLDQVDQAGAFSVVG
Ga0315286_1127542013300032342SedimentMSVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYTAPPEPVYAEPGDSTYFVNPVWHIPDDAQLGSYQADFYIYNYYDSRTGELSKQLDQVDQVSAFSVVG
Ga0315287_1162610823300032397SedimentDTISAQIDSFDFPSGDWYRWSDQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVNPIWHIPDDAQLGSYQADLYLYSYYDSRTGELSEQLDQVNQAGAFSVV
Ga0315275_1063070533300032401SedimentMSELKAVTKKYLVVIDMKRVLVCILLLLLWISVDSVSADTISAQIDSFDFPSGDWYRGSDQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAQPGSSTYFVNPIWHIPDDAQLGSYQADLYLYSYYDSRTGELSEQLDQVNQAGAFSVVG
Ga0315275_1105231523300032401SedimentMKRVLLCILLLLLWISADSVSADTISAQIDSFDLPSGDWYRGSNQGGSQNVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG
Ga0315273_10000940143300032516SedimentMKRVLVCILLLLLCMSVDCVSADTISAQIDSFDFPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAEPGDSTYFVNPVWHIPDDAEIGSYQADFYLYGYYDSRTGELSNQLDQVDQVSAFSVVG
Ga0315273_1320612313300032516SedimentMSELKAVTKKYLVVIDMKRVLVCILLLLLWISVDSVSADTISAQIDSFDFPSGDWYRGSDQGGVNVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPEPVYAKPGSSTYFVNPIWHIPDDAQLGSYQADLYLYSYYDSRTGELSEQLDQVDQAGAFSVV
Ga0316625_10091414313300033418SoilMKRVLVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVNPVWNIPDDAELGNYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG
Ga0316601_10162815713300033419SoilMKIILVCILLSLLWIGVDSVSADTISAQIDSFDLPSGDWYRGSNQGGANVWIKNTGDVGHLFWVSYQVMDKRGQWYSAPPESVYAKPGDSTYFVSPVWNIPDDAELGSYQADFYLYGYYDSRTGELSEQLDQVDQVGAFRVVG
Ga0370480_0001950_2774_32473300034169Untreated Peat SoilMKRTVAKIYLEVVGMKRVLIGILLLLLCVSMNSASAGSISAKIDSSDFPSGDWYQGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPVSVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYAYYDTYTGELLDQLDQVAQVSAFSVVG
Ga0370501_0143033_379_8103300034195Untreated Peat SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGLDQGGANVWIKNTGDISHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDDAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSSFSVVG
Ga0370481_0002035_2906_33373300034281Untreated Peat SoilMKRVLIGILLLLLCVSVDSASAGSISAQIDSFDFPSGDWYRGSDQGGANVWIKNTGDIGHTFWVSYEVMDRRGKWYTAPPESVYAEPGSDTYFVSPRWHIPDNAEIGGYQADFYLYGYYDPYTGELSDQLDQVAQVSAFSVVG
Ga0370481_0226616_2_4003300034281Untreated Peat SoilMKITKINLWVMDMKGAILGILLLLLCLSVGSAIAETISAQIDSQYFPSGDWYRGSNQGGANIWIKNTGDVGHLFWISYEVMDSRGRWYTAPPVSVYADTGDGATYFANPVWTIPYDAEMGSYQADFYVYGYYD
Ga0316598_194229_45_4283300034652Untreated Peat SoilVDSASADLISAQIDSFDFPSGDWYRGSNQGGANVWIENTGDVGHTFWVSYEVMDKRGKWYTAPPESVYAEPGTDTYFVSPVWNIPDDAELGLYQADFYLYGYYDNSTGELSEQLDQVDQVSAFSVVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.