Scaffold 2001205718

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2001205718

Scaffold 2001205718

Overview

Basic Information
Taxon OID	2001200001 Open in IMG/M
Scaffold ID	2001205718 Open in IMG/M
Source Dataset Name	Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	1129
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Waseca County, Minnesota, Usa

Source Dataset Sampling Location
Location Name	Waseca County, Minnesota, USA
Coordinates	Lat. (^o)	44.152652	Long. (^o)	-93.519745	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078898	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
2001219537	F078898	AGG	MDLSKRQLLQDALAKAEAHHAFIAVSTPSGTRILLRPDFTCYETYVEGTGADGQLLTLTYEQIASVDVE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.