NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2001297459

Scaffold 2001297459


Overview

Basic Information
Taxon OID2001200001 Open in IMG/M
Scaffold ID2001297459 Open in IMG/M
Source Dataset NameSoil microbial communities from Waseca County, Minnesota, USA - Sample 10150
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)998
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Waseca County, Minnesota, Usa

Source Dataset Sampling Location
Location NameWaseca County, Minnesota, USA
CoordinatesLat. (o)44.152652Long. (o)-93.519745Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085672Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
2001349474F085672N/AMSEERTFPVTLMRAGPGLPYFEVGAYRYTAEWLPSAGDLITVTKPAATELDPVEPLLVYVTRVEPNADTPIRATEAKGLSVETTDELIVAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.