Basic Information | |
---|---|
Taxon OID | 2001200004 Open in IMG/M |
Scaffold ID | 2001413554 Open in IMG/M |
Source Dataset Name | Fossil microbial communities from Whale Fall, West Antarctic Peninsula - Bone |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 859 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Fossil → Whale Fall → Fossil → Fossil Microbial Community From Whale Fall, Santa Cruz Basin Of The Pacific Ocean And West Antarctic Peninsula |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Santa Cruz Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -65.1 | Long. (o) | -64.47 | Alt. (m) | Depth (m) | 1670 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073087 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2001511754 | F073087 | AGGA | MNTQHQTSFTKAIIGSTQRLFRSNKNHSLLANSFINARTMKDIGVNPVGLN |
⦗Top⦘ |