NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2001413554

Scaffold 2001413554


Overview

Basic Information
Taxon OID2001200004 Open in IMG/M
Scaffold ID2001413554 Open in IMG/M
Source Dataset NameFossil microbial communities from Whale Fall, West Antarctic Peninsula - Bone
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)859
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Fossil → Whale Fall → Fossil → Fossil Microbial Community From Whale Fall, Santa Cruz Basin Of The Pacific Ocean And West Antarctic Peninsula

Source Dataset Sampling Location
Location NameSanta Cruz Basin, Pacific Ocean
CoordinatesLat. (o)-65.1Long. (o)-64.47Alt. (m)Depth (m)1670
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073087Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
2001511754F073087AGGAMNTQHQTSFTKAIIGSTQRLFRSNKNHSLLANSFINARTMKDIGVNPVGLN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.