NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2004354518

Scaffold 2004354518


Overview

Basic Information
Taxon OID2004247008 Open in IMG/M
Scaffold ID2004354518 Open in IMG/M
Source Dataset NameHypersaline mat microbial communities from Guerrero Negro, Mexico - 22-34 mm depth into microbial mat
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)695
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Microbial Mats → Hypersaline Mat → Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico

Source Dataset Sampling Location
Location NameGuerrero Negro, Baja California Sur, Mexico
CoordinatesLat. (o)27.68908Long. (o)-113.917Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015419Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
2004361027F015419N/AMKYELKITDENGNEHLYNVSRSSFDEERSLNDFILEALQVSEDKRKLPLITQCPNGLEVYPKIKMKFENYGSSLLGDELEAMAIGWQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.