Basic Information | |
---|---|
Taxon OID | 2006543006 Open in IMG/M |
Scaffold ID | 2006884114 Open in IMG/M |
Source Dataset Name | Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 790 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Anoxic Basin Of Saanich Inlet In Vancouver, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Saanich Inlet, British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 48.616667 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 100 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043198 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2007030487 | F043198 | GAG | MQGITMKGSRGSGLSATDGLSFLCKDMTFTQCGNHGVFAMNTEGRLINCVITQCRWSGIFCSMNALIELEGDQTKVDGNLTSGNSRYYGLDTFKTSSIIHLLFPLTKESVSTNNHNGQNYGGDGTIETVNTLESFSYE |
⦗Top⦘ |